KEGG   Yersinia enterocolitica LC20: LC20_03719Help
Entry
LC20_03719        CDS       T03179                                 

Definition
(GenBank) histidine ABC transporter ATP-binding protein HisP
  KO
K10017  histidine transport system ATP-binding protein [EC:7.4.2.1]
Organism
yel  Yersinia enterocolitica LC20
Pathway
yel02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:yel00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    LC20_03719
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:yel02000]
    LC20_03719
Enzymes [BR:yel01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.1  ABC-type polar-amino-acid transporter
     LC20_03719
Transporters [BR:yel02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Lysine/arginine/ornithine transporter
    LC20_03719
   Histidine transporter
    LC20_03719
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_15 AAA_29 AAA_13 ABC_ATPase AAA_23 AAA_16 G-alpha PRK AAA_24 RsgA_GTPase AAA_33 Mg_chelatase AAA_22
Motif
Other DBs
NCBI-ProteinID: AHM74972
Position
complement(3214208..3215005)
Genome map
AA seq 265 aa AA seqDB search
MTDMLEPKIAETKLSVTELHKHYGEHEVLKGVSLSAKAGDVISIIGSSGSGKSTFLRCIN
FLEKPSEGSISVNNQDIRLVRDKDGQLKVFDKKELQLLRTRLTMVFQHFNLWSHMTVLEN
VMEAPVQVLGLSKSVAKERAIRYLDKVGIDERARAKYPVHLSGGQQQRVSIARALAMEPD
VLLFDEPTSALDPELVGEVLRIMQKLAEEGKTMVVVTHEMEFARHVSSHVIFLHKGVIEE
EGPPAELFGNPKSTRLQQFLSGALK
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgactgacatgttagaacctaaaatagctgaaaccaaattgtctgtgacagaattacat
aagcactatggcgaacatgaagttttaaaaggggtgtcactttcagcgaaagccggggat
gtgatttctattattggctcctctggttcagggaaaagtacttttttacgttgcatcaac
tttttagaaaaacccagtgaaggttcaattagcgtcaataatcaggatatccgcctagtg
cgtgataaagatgggcaattaaaagtctttgataaaaaagagctgcaattattacgcacc
cggctaacgatggtattccagcatttcaacttgtggagccacatgactgtgctggaaaat
gtcatggaggccccagttcaagtattggggttgagtaagtcagtggcaaaagagcgcgct
attcgttatttggataaagtcgggattgatgagcgcgcgcgggccaaatatcccgtgcat
ctttctggtggccagcagcagcgtgtttctattgctcgggcactggctatggagccagat
gtattattgtttgatgagcccacctcggcgctggatccggaattagtgggggaagttttg
cgaattatgcagaagctggcagaagaggggaaaacgatggtcgtggtgactcacgaaatg
gagtttgcacgccatgtctccagccatgttattttcctgcacaaaggtgtcattgaagaa
gaggggccgccagccgagctatttggcaacccaaaaagtacccggctgcagcagttcctg
tctggcgcactgaagtaa

DBGET integrated database retrieval system