KEGG   Yersinia enterocolitica LC20: LC20_04403Help
Entry
LC20_04403        CDS       T03179                                 

Gene name
cobA
Definition
(GenBank) uroporphyrinogen-III C-methyltransferase
  KO
K02302  uroporphyrin-III C-methyltransferase / precorrin-2 dehydrogenase / sirohydrochlorin ferrochelatase [EC:2.1.1.107 1.3.1.76 4.99.1.4]
Organism
yel  Yersinia enterocolitica LC20
Pathway
yel00860  Porphyrin and chlorophyll metabolism
yel01100  Metabolic pathways
yel01110  Biosynthesis of secondary metabolites
yel01120  Microbial metabolism in diverse environments
Module
yel_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:yel00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    LC20_04403 (cobA)
Enzymes [BR:yel01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.76  precorrin-2 dehydrogenase
     LC20_04403 (cobA)
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     LC20_04403 (cobA)
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.4  sirohydrochlorin ferrochelatase
     LC20_04403 (cobA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TP_methylase NAD_binding_7 CysG_dimeriser Sirohm_synth_M Shikimate_DH 2-Hacid_dh_C Yop-YscD_cpl XdhC_C HTH_15
Motif
Other DBs
NCBI-ProteinID: AHM75656
Position
complement(3808837..3810255)
Genome map
AA seq 472 aa AA seqDB search
MDYLPLFADLKRRPVLVVGGGEVAARKIDLLHRAGAQVRVVAQTLSAQLEQQYQDGRIHW
LALDFLPEQLDEVFLVIAATNDTALNAAVFAAADERHLLANVVDDQPRCSFIFPSIVDRS
PLVVAISSAGQAPVLARLLREKLEALLPSSLAQMATIAGRWRGRVKQQLTSMGARRRFWE
NAFSGRFASFVSRGQLAQAEDELQLALEGQGSTQGEVALVGAGPGDPGLLTLRGLQVIQQ
ADVVLYDHLVSPEVLDLVRRDAERICVGKRAGAHSVAQEETNQLLLTFAQRGKRVVRLKG
GDPFIFGRGGEELQVVARAGIPFQVVPGVTAAAGATAYAGIPLTHRDHAQSVTFITGHCR
SDGADLDWQALARGHQTLAIYMGTVKAAEISRKLIMHGRASTTPVAVIGRGTRTDQQVLT
GTLAELESLAHQAPTPALLVIGEVVDLHHQIAWFGQQPQTEQAISPSVVNLA
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
gtggactatctacctctttttgccgacttgaaacgacgcccggtattggttgttggcggc
ggtgaagttgctgcgcgaaaaattgacttactccaccgcgcaggcgcacaggtgcgggta
gtggcacagaccctctcagcacaacttgagcaacaatatcaggatggccgcattcactgg
ctggcattggatttcttgcccgagcagttggatgaagtatttctggtgattgccgcgact
aatgacacggcattaaacgcggcggttttcgcagcggcagatgagcggcatcttttggct
aatgtggttgatgaccaaccgcgctgttcatttatcttcccctcaattgtcgatcgctcc
ccactggtggtggcgatctcctcggctggtcaagcacccgtgctggcgcgcttactgcgc
gagaaactggaagctttgttacccagcagtttggcgcagatggcaactattgccgggcgt
tggcgtggccgggttaaacagcagttgacctcaatgggcgcgcggcgacgtttttgggaa
aacgcctttagtgggcgctttgccagttttgtcagccgtgggcagttggcgcaggccgaa
gacgaactgcaattggcgctggaggggcagggcagtactcaaggcgaggttgccttagtc
ggtgcagggccaggagatcctggcttattgaccttacgtggcctgcaagttattcaacaa
gctgatgtggtgctttatgaccatttagtcagcccagaagtgctggatttggtgcgccgt
gatgctgaacgtatttgtgtcggcaagcgtgccggggcgcattcggtcgcgcaggaagaa
accaatcaattattgctcaccttcgcgcagcgcggaaaacgggtggtgcggctaaaaggg
ggcgacccttttatctttggccggggtggcgaagagctacaagttgtggcgcgcgcgggc
attccgtttcaggtggtgccaggggtgacggccgctgcgggggcaaccgcctatgccggt
atcccattgactcaccgtgaccacgcgcaaagtgtgacatttattaccgggcattgccgc
tctgatggtgctgatttggattggcaggcattggcgcgcggtcatcaaactttggctatc
tatatgggcacggtgaaagcggctgaaatcagccgaaaattaataatgcatggtcgagcc
agcaccacgccagtggcggtgattgggcggggaacgcgtaccgaccagcaagttttgacc
ggcacattggcagagctggaatcattagcacatcaggccccaacaccggcactgctggtt
atcggtgaagtggtggatttacatcatcaaattgcctggtttgggcagcaaccgcagact
gaacaggccatcagcccgtcagtcgtgaatttggcataa

DBGET integrated database retrieval system