KEGG   Yersinia enterocolitica subsp. enterocolitica 8081 (serotype 0 8): YE0742Help
Entry
YE0742            CDS       T00469                                 

Gene name
barA
Definition
(RefSeq) hybrid sensory histidine kinase BarA
  KO
K07678  two-component system, NarL family, sensor histidine kinase BarA [EC:2.7.13.3]
Organism
yen  Yersinia enterocolitica subsp. enterocolitica 8081 (serotype 0:8)
Pathway
yen02020  Two-component system
Brite
KEGG Orthology (KO) [BR:yen00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    YE0742 (barA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:yen01001]
    YE0742 (barA)
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:yen02022]
    YE0742 (barA)
Enzymes [BR:yen01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     YE0742 (barA)
Protein kinases [BR:yen01001]
 Histidine kinases
  NarL family
   YE0742 (barA)
Two-component system [BR:yen02022]
 NarL family
  BarA-UvrY (central carbon metabolism)
   YE0742 (barA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2222 HATPase_c Response_reg HisKA Hpt HAMP
Motif
Other DBs
NCBI-GeneID: 4715900
NCBI-ProteinID: YP_001005086
UniProt: A1JJQ9
Position
complement(863360..866194)
Genome map
AA seq 944 aa AA seqDB search
MTKYSLRARMMILILAPTLLLGLLLSTTFMVNRYNELQKQLVNAGTNIIEPLAVASEYGM
TFRNRDTVRQLINLLHRRHSNIVRSISVFDADNNLFVTSNYNYNSSQLRLPKDDAIPSSL
MLSYRGDSLILRMPIVSESNLSSDRSSDSDITNRPLGYIAMDLDLQSVRLQQYKEIFIST
LLLLFCMCVAILFAYRLMRDVTGPIRNMVNAVDRIRRGQLDSRVEGHMLGELNILKNGIN
SMAMSLAAYHEEMQQNIDQATSDLRETLEQMEIQNVELGLAKKRAQEAARIKSEFLANMS
HELRTPLNGVIGFTRQTLKTSLTPTQTDYLQTIQRSANNLLCIINDVLDFSKLEAEKLIL
EHIPFSLRGALDEVIILLAHTAHEKGLELTLHVNKDVPEQVIGDAMRLQQIVTNLLGNAI
KFTEQGNIDILVAVRAIASQQVTLVVEIHDTGIGISESQQAQLFQAFRQADASISRRHGG
TGLGLVITERLVKEMGGDISFHSQVDRGSTFRFHLTLDLNEAIPSRRPDMSHLEGKTLAY
IERNAAAARATLDILSITPLQVTHSLTLAQLPIQHYDFLLVGVPIPYRNNMAVHQDKLIA
AMKISEQVILALPSQSQVEAEQLKQIGAKACLVKPISANRLIPLLSYEKAHSELPVVEQA
HKQPKLPFKVMAVDDNPANLKLMGTLLEEQVEETVLCDSGAKAIAYARENTLDIILMDIQ
MPEIDGIRASEVIHQMSHHQDTPIIAVTAHAVRGQQEQLLKLGMADYLAKPIDEARLIQA
LSRYLPDSASQLHDEQPHALQQSHVLQQSHTLQQQGESEAHIQSVPQSECKESIDWPLAV
RQAANKEALAKDLLTMLLEFTPQVIQRVQAILAGSHDDDILNLIHKFHGSCACSGVPRLR
QLCMTIEQQLRQQTDVQDLQPEWLELLDEIDNVRFAARNYLGAA
NT seq 2835 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaatacagtcttcgcgcgcgcatgatgattttaatcctggcccccacgctgctt
cttgggctgttactcagtacgacctttatggtcaatcgttacaatgaactgcaaaaacaa
ttagttaacgcaggtacaaatattatcgaaccgctggcggttgccagtgagtacggaatg
acctttcgcaaccgcgatactgtccgtcagttaattaatctgcttcaccgtcgccattcg
aatattgttcggtcaatatcagtttttgacgcagataataatctttttgtcacatctaac
tataattacaattcctcacaattaagattgccgaaagacgacgctattcccagttcactg
atgctttcctaccgtggcgactctttgattctgcgcatgcctattgtttcagaatccaac
ctgtccagtgaccggtcttctgattcagacataaccaatcggccattgggctatatcgcc
atggacttggatttacaatccgtacgcttgcagcaatataaagaaatctttatttcgact
ctactgctgctgttctgtatgtgtgtggcaatcttgtttgcttatcggctgatgcgtgat
gtcactggccccatccgtaacatggtgaacgctgttgaccgcattcgccgcgggcaatta
gacagccgggtggaagggcatatgctcggcgagttgaatattttgaaaaatggtatcaac
tcgatggcaatgtcactggcggcctatcacgaagagatgcaacagaatatcgatcaagcc
acgtcagacttgcgtgaaacgctggagcagatggaaatccagaacgtggaattggggctg
gcgaaaaaacgtgctcaagaagccgcgcgaattaaatccgaatttctggctaatatgtcc
catgaattacgtactccactcaatggggtgattggttttacccgccagacactgaaaaca
tcactgaccccaacgcaaactgactatctgcaaactatccagcgatcagcaaataacctg
ttatgcatcattaatgacgtgctggatttctccaagttagaggccgaaaagctgattctt
gagcatatcccgttctcactacgcggcgcgctagatgaagtcattattctgctggcacac
accgctcatgaaaaaggcctggaactgaccctacatgttaataaagatgtgccggaacaa
gtgattggcgatgccatgcgtttgcagcaaatagtcacaaacttgctgggtaatgcgatt
aaattcaccgaacagggcaatatcgatattctggtggcagtacgagcaatagccagccaa
caggtgacgctggtggtagaaattcacgataccggcattggtatttccgaatctcagcaa
gcccaactgttccaggcattccgtcaggccgatgccagtatttcacgtcgccacgggggt
accggccttgggctagttatcaccgaaagattggtgaaggaaatgggtggcgatatcagc
ttccacagtcaggttgatcggggttcgactttcaggttccacctgacgttggatctcaat
gaagccattccctcccgccgcccagatatgtcgcatctggaagggaaaacgctggcctat
attgaacgtaatgccgctgcggcaagagcaacattagatattctcagcatcactccttta
caggtgactcatagcctgacgttagcccagttgccgatacaacattatgatttcctgctc
gtcggggtgcctatcccgtaccgcaataatatggctgttcatcaagacaaactgatcgca
gcaatgaaaatttccgagcaagttattttggcattgccgagccaatcacaggtagaagcg
gagcaacttaaacagatcggcgctaaagcatgcctggttaagcccatatccgctaaccgg
ttaattcctttattgtcttatgaaaaggcgcatagtgaattaccggtggtagagcaagca
cacaagcagcccaagctgcctttcaaagtgatggccgttgatgacaacccagctaacttg
aaattaatggggactttgctggaagaacaggttgaagaaacagtgttatgtgacagcgga
gcaaaagccatagcctatgcccgtgaaaatacgctagatatcattttaatggatattcaa
atgccggaaattgacggcatccgcgccagtgaagtgattcatcagatgtcacatcatcag
gacaccccgatcattgcagtcacggctcacgccgttagagggcagcaggaacaattacta
aaattgggtatggctgattatctcgcgaaacctattgatgaagctcggctgatacaagct
ctttcgcgttatctacctgatagtgcttcacaacttcatgatgaacagcctcacgcttta
cagcaatctcatgttttacaacaatcccacaccttacaacaacagggcgaaagtgaggct
catattcagtcagttccgcaatctgaatgtaaagagtcaatagactggccacttgcggtg
aggcaagcagcaaataaagaagcactggctaaagaccttttaaccatgttgttagagttt
acgccacaagtgatacagcgcgtgcaggcgattctagccggtagccatgacgatgatatt
ctgaatctgattcacaagtttcatggcagttgcgcatgtagcggtgtgccgcgactgcgg
caattgtgcatgacgattgaacaacaattgcgccaacaaactgacgtacaagacttacaa
cctgagtggcttgagttgttagatgagatagacaatgtccgctttgctgcacggaattat
ctcggcgcagcctaa

DBGET integrated database retrieval system