KEGG   Yersinia enterocolitica subsp. enterocolitica 8081 (serotype 0 8): YE0755Help
Entry
YE0755            CDS       T00469                                 

Gene name
cysJ
Definition
(RefSeq) sulfite reductase subunit alpha
  KO
K00380  sulfite reductase (NADPH) flavoprotein alpha-component [EC:1.8.1.2]
Organism
yen  Yersinia enterocolitica subsp. enterocolitica 8081 (serotype 0:8)
Pathway
yen00920  Sulfur metabolism
yen01100  Metabolic pathways
yen01120  Microbial metabolism in diverse environments
Module
yen_M00176  Assimilatory sulfate reduction, sulfate => H2S
yen_M00616  Sulfate-sulfur assimilation
Brite
KEGG Orthology (KO) [BR:yen00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    YE0755 (cysJ)
Enzymes [BR:yen01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.2  assimilatory sulfite reductase (NADPH)
     YE0755 (cysJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavodoxin_1 FAD_binding_1 NAD_binding_1
Motif
Other DBs
NCBI-GeneID: 4716107
NCBI-ProteinID: YP_001005099
UniProt: A1JJS2
Position
880250..882055
Genome map
AA seq 601 aa AA seqDB search
MTTQVPPSSLLPLSPEQLARLQAAVGEFSPTQMAWLSGYFWGMVNQQPGAVVAPAVAAPA
AVTITLISASQTGNARRLAEQLRDDLVAAKLNVNLVNAGDYKFKQIAQERLLVIVASTQG
EGEPAEEAVALYKFLFSKKAPKLPETAFAVLGLGDTSYEHFCQAGKDFDNKLAELGAQRL
LERVDADVEYQESAQQWRQQIVAALQARVPAQSAAAVAVTPSGAVDEITSSPYSKAAPLT
AQLSVQQKVTGRNSEKDVRHIEIDLGDSGLRYQPGDALGIWFDNDPALVEELLALLWLKG
DEQVSIDGQNISLSQALRSHLELTQNTTLIVDKYAALSRDEKLIALLADKSALQHYAKNT
PIVDMVRQAPSDLNADQLVALLRPLTPRLYSIASSQAETENEVHVTVGVVRYDIDGRPRT
GGASGYLADRLEVDGDIRIFIEHNDNFRLPANPETPVIMIGPGTGIAPFRAFMQQREADG
ATGKNWLLFGNPHFTEDFLYQVEWQRYVKDGLLTRIDLAWSRDQADKIYVQDKLREQGAE
LWNWIQQGAHIYVCGDANRMAKDVEQVLLDVVALHGAMDAEQADEYLSELRLARRYQRDV
Y
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atgacgactcaggttcctcctagttctttacttccgctatcgccggagcagttagcccgc
ttgcaggcggcggtgggtgagttttccccaacccaaatggcatggttatctggctacttt
tggggcatggttaatcagcaacccggtgcggttgttgctcctgctgtagcggcccctgcg
gcggtaactattaccctgatttctgcctctcaaaccggtaatgcacgccgcttggccgaa
cagttacgcgatgaccttgtggctgccaaacttaacgtcaatctggttaacgccggtgat
tataagtttaagcagatcgcgcaagagcgcttgctggttattgtggcctccactcaaggt
gaaggtgagccggctgaagaggctgttgccctgtataagttcctattctctaaaaaagcg
ccgaaattgccagaaactgcctttgcggtattgggtttaggcgatacctcatacgagcat
ttttgtcaggcaggcaaagacttcgacaacaaattggctgagttgggtgcacagcgatta
ttggagagagtcgatgctgatgtggaatatcaagaatccgcacagcagtggcgtcaacaa
attgtggcggcattgcaggcaagagtccccgcgcaatcagcggctgcggtagcagtaaca
ccaagcggcgcggttgatgaaattacctccagcccatatagcaaggctgcgccactgacc
gcacagttatctgtgcagcaaaaagtgaccggccgcaactctgagaaagatgtacgccat
attgaaattgatttaggggactccgggctgcgctatcagccgggcgatgctctgggtatc
tggtttgataatgacccggcattggtcgaagagttgttggcgctattgtggcttaaaggt
gatgagcaggtcagtattgatgggcagaatatatcgctgtcgcaagcactgcgcagccat
cttgagctgacacaaaataccaccctgatcgtcgataaatatgcagcactttcccgtgat
gaaaaattgattgctttgctggcggataaatcagcgctgcaacattatgcgaagaatacc
ccaattgttgatatggttcgtcaggccccttcagacctgaatgccgatcaactggttgcg
ctgttacggccactaacacctcggctctattccatcgcctcctcacaggctgaaaccgag
aatgaagtgcatgttacggtcggtgtggtgcgctatgacattgatggtcggccacgtact
ggtggtgcatcgggttatctggcagatcggctggaagtggatggtgatattcgtatcttt
atcgaacataacgataacttccgattaccggctaacccagaaacgccagtgataatgatt
gggccaggaaccggtatcgcccccttccgtgcgtttatgcagcagcgcgaagccgatggt
gctacgggcaagaactggttacttttcggcaacccgcattttactgaagattttctctat
caggtcgaatggcaacgctatgtcaaagatggcttgctgacccgtattgatctggcatgg
tcgcgcgatcaagccgataaaatatatgtacaagacaaactgcgcgaacaaggtgcagaa
ctgtggaactggatccaacaaggtgcccacatttacgtctgtggtgatgctaatcgcatg
gcgaaagacgttgagcaggttttactggacgtggtggctctgcacggcgcgatggatgct
gagcaggctgatgaatatttaagtgagctgcgcctggcgcgccgttatcagcgggatgtg
tactga

DBGET integrated database retrieval system