KEGG   Yersinia enterocolitica subsp. enterocolitica 8081: YE0958Help
Entry
YE0958            CDS       T00469                                 

Definition
(RefSeq) urea transporter
  KO
K08717  urea transporter
Organism
yen  Yersinia enterocolitica subsp. enterocolitica 8081
Brite
KEGG Orthology (KO) [BR:yen00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:yen02000]
    YE0958
Transporters [BR:yen02000]
 Other Transporters
  Pores ion channels [TC:1]
   YE0958
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UT
Motif
Other DBs
NCBI-GeneID: 4716499
NCBI-ProteinID: YP_001005292
UniProt: A1JKE4
Position
1081767..1082756
Genome map
AA seq 329 aa AA seqDB search
MNAKTGNQSGWAQLSASNVFIEFIDTTLRGCAQVMFQNNPLTGLFFFIAIFVGAYGEGNP
AVAYGCVLGTIVATLTGLTMRDRKSWRSGLYGYNGCLVGAALPTFLVATPIVWACIVLGS
IVSVIVMVCIADILKTWKVAALTAPFVLTTWMILLASYAFAGLHSSGLPTPALPHPLVLD
SGATASGNLFVSMFNGVSQVFLFSSLIGGILFIIGLAVESLWAAVFAVGGSLLALFTAIF
LGANPSSIDAGLYAFSAVLTAIALGSTFNKPSWRVLAYTIVGVIFTVIVQGALNILLSPI
GIPTLTMPFVLASWLFLVPNKDVMPAHRQ
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcgaaaacgggcaatcaatccggctgggcacaacttagtgcttcgaatgttttc
attgaatttatcgatacaacgctgcgcggctgtgctcaagtcatgttccagaataaccct
ctgaccgggctattcttttttatcgcaatatttgtcggagcctatggcgaagggaacccg
gcggtggcttatggttgtgtgctgggaacaatagtggcaacactcaccgggctaacgatg
cgcgatcgtaaatcatggcgctcagggttatacggctataacgggtgtttggtgggggcg
gcattaccgacatttttggttgccacaccgatagtctgggcatgcattgttttaggtagc
atcgtgtcggtcattgttatggtttgtatcgccgatattttaaaaacttggaaagttgcg
gcattaactgcaccttttgttctcactacctggatgatcttgttggccagttacgccttt
gccggtttacatagcagtggattacctaccccggctctacctcatccgttggttttagat
agtggagcaactgcgagtggtaatcttttcgtcagcatgttcaatggtgtttctcaggta
tttttattcagtagtttgattggcggcattctttttatcatcgggctggcggttgaatcg
ctctgggccgccgtatttgccgtgggtggttcactattggcgcttttcaccgctatattc
cttggagcaaacccgagcagtattgatgccggactttatgcattcagtgcggtattgacg
gcgatcgctttaggttcgacatttaacaagcccagttggcgcgttttggcttataccatc
gtcggcgttatttttacggtcatcgtacagggcgctctgaatattttattgtcccctatc
ggtattccaaccttgacgatgccatttgttctcgcttcatggttattcctggttcctaat
aaagatgtgatgccagcacatagacaatag

DBGET integrated database retrieval system