KEGG   Yersinia enterocolitica subsp. enterocolitica 8081: YE1225Help
Entry
YE1225            CDS       T00469                                 

Gene name
glk
Definition
(RefSeq) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
yen  Yersinia enterocolitica subsp. enterocolitica 8081
Pathway
yen00010  Glycolysis / Gluconeogenesis
yen00052  Galactose metabolism
yen00500  Starch and sucrose metabolism
yen00520  Amino sugar and nucleotide sugar metabolism
yen00521  Streptomycin biosynthesis
yen01100  Metabolic pathways
yen01110  Biosynthesis of secondary metabolites
yen01120  Microbial metabolism in diverse environments
yen01130  Biosynthesis of antibiotics
yen01200  Carbon metabolism
Module
yen_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
yen_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:yen00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YE1225 (glk)
   00052 Galactose metabolism
    YE1225 (glk)
   00500 Starch and sucrose metabolism
    YE1225 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    YE1225 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    YE1225 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    YE1225 (glk)
Enzymes [BR:yen01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     YE1225 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase PaaX_C
Motif
Other DBs
NCBI-GeneID: 4713068
NCBI-ProteinID: YP_001005548
UniProt: A1JLD7
Position
1365353..1366324
Genome map
AA seq 323 aa AA seqDB search
MTSYALVGDVGGTNARLALCAVATGEISQAKTYSGLDYDSLEAVIKQYLSEHKVTVEHAC
IAIACPITGDWVAMTNHTWAFSIAAMQQNLGLKHLEIINDFTAVSMAIPMLSEQDVLQFG
GTSPQPGKPVAVYGAGTGLGVAHLVNVDSRWISLPGEGGHVDFAPNSEEEDRILAVLRQE
LGHVSAERVLSGPGLVNLYRAIVISDGRLPENLAPKDVTERALADSCTDCRRALSLFCVI
MGRFGGNLALNLSTFGGVYIAGGIVPRFMEFFKASGFRGAFEDKGRFKDFLQDIPVYMIT
HQQPGLLGAGAYLRQKLGYTLHP
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgacgagctatgccctggtgggtgacgttggcggcactaatgcccgtttggcgctttgc
gctgtggcgacgggcgaaatatcacaagcaaaaacatattcagggttagattacgacagt
ctggaagctgtcattaagcaatatttatcagagcataaggtcactgtagagcatgcctgt
attgctatcgcctgcccgattaccggagattgggtggcaatgaccaatcacacttgggca
ttctctatcgcggcgatgcagcaaaacctcgggctgaagcacttagagatcattaatgat
ttcaccgcggtatcaatggcaattcccatgttgtctgagcaggatgtgctgcaatttggc
ggtacatcgccacagccgggtaaaccggtagcggtatacggtgctgggacggggttaggg
gtggcacatttagttaatgtggatagccgctggataagcttgccgggtgaaggcggacat
gtggattttgcgcccaatagcgaagaagaagaccggattttggcggtactgcgtcaggaa
ctgggccacgtttccgccgagcgagtgctttccgggccggggctggtcaatttataccgg
gccattgtgatttctgatggtcgtctgcccgaaaatctggcaccgaaagatgtgactgaa
cgcgctctggcagacagttgcactgattgtcgccgcgcattatcactgttttgcgtaatt
atggggcgctttggcggcaatttggccttgaatctcagtactttcggtggcgtgtatatc
gctggcggaattgtgccgcgctttatggaattctttaaagcttccggcttccgcggtgct
tttgaagataaagggcgtttcaaagatttcttacaggatattccggtctatatgatcacg
caccagcaacctggtttgctgggcgcaggggcttatttacgtcagaagttagggtatact
cttcatccttaa

DBGET integrated database retrieval system