KEGG   Yersinia enterocolitica subsp. enterocolitica 8081 (serotype 0 8): YE2190Help
Entry
YE2190            CDS       T00469                                 

Definition
(RefSeq) bifunctional UDP-glucuronic acid decarboxylase/UDP-4-amino-4-deoxy-L-arabinose formyltransferase
  KO
K10011  UDP-4-amino-4-deoxy-L-arabinose formyltransferase / UDP-glucuronic acid dehydrogenase (UDP-4-keto-hexauronic acid decarboxylating) [EC:2.1.2.13 1.1.1.305]
Organism
yen  Yersinia enterocolitica subsp. enterocolitica 8081 (serotype 0:8)
Pathway
yen00520  Amino sugar and nucleotide sugar metabolism
yen01100  Metabolic pathways
yen01503  Cationic antimicrobial peptide (CAMP) resistance
Module
yen_M00761  Undecaprenylphosphate alpha-L-Ara4N biosynthesis, UDP-GlcA => undecaprenyl phosphate alpha-L-Ara4N
Brite
KEGG Orthology (KO) [BR:yen00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    YE2190
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    YE2190
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:yen01005]
    YE2190
Enzymes [BR:yen01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.305  UDP-glucuronic acid dehydrogenase (UDP-4-keto-hexauronic acid decarboxylating)
     YE2190
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.13  UDP-4-amino-4-deoxy-L-arabinose formyltransferase
     YE2190
Lipopolysaccharide biosynthesis proteins [BR:yen01005]
 Unusual sugar
  YE2190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd Formyl_trans_N Formyl_trans_C 3Beta_HSD NAD_binding_10 NAD_binding_4 TrkA_N
Motif
Other DBs
NCBI-GeneID: 4715463
NCBI-ProteinID: YP_001006430
UniProt: A1JPN5
Position
complement(2399017..2401080)
Genome map
AA seq 687 aa AA seqDB search
MKAIVFAYHDIGCVGLKALVEAGYDIQAVFTHTDSPNENRFFSSVARVAADLDLPVFAPE
DVNHPLWIERIQQLQPDIIFSFYYRNMLCDDILSSAPRGGFNLHGSLLPKYRGRAPINWV
LVNGETETGVTLHQMVKKADAGPIVGQHKVMISGSDTALTLHTKMRDAANELLRDLLPKM
KNASLPLEPQKESEASCFGRRTADDGAIDWQKSALAINNLVRAVTEPYPGAFSYLGQRKL
IIWRSQPLDVVHSKLAGTVLSTSPLVVACGDGALEIITGQGEEGLYVQGSRLAQEMGIVT
GIRLGNKPSQKLKRRTRVLILGVNGFIGNHLTERLLRDNRYEVYGLDIGSDAICRFLDNP
NFHFVEGDISIHSEWIEYHIKKCDVILPLVAIATPIEYTRNPLRVFELDFEENLKIVRDC
VKYNKRIVFPSTSEVYGMCDDKEFDEDSSRLIVGPINKQRWIYSVSKQLLDRVIWAYGAK
ENLKFTLFRPFNWMGPRLDNLDAARIGSSRAITQLILNLVEGSPIKLVDGGEQKRCFTDI
HDGIEALFRIIENRDGACDGQIINIGNPTNEASIRELAEMLLRCFEKHELRHNFPPFAGF
KDIESSAYYGKGYQDVEYRTPSIRNARRILDWQPEIALEQTVMETLDFFLRGVVLEQNVL
EQNVLEQNVLEQNVIEQSKTSKDEHHV
NT seq 2064 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcgattgtatttgcctatcacgatattggctgtgtcggcctgaaagctcttgtt
gaagcaggttacgatattcaggcagtatttacccatactgactcacccaatgagaatcgc
tttttctcttctgtagccagagtggctgcggatttagatttacccgtatttgcgccagaa
gatgttaaccacccgctgtggattgagcgtattcagcaattacagccagatatcattttc
tctttctattatcgcaatatgctttgtgatgacattttgtcgtcggctccgcgtggagga
ttcaatttacatgggtccttattaccgaagtatcgcggccgggcaccgatcaactgggtt
ttggttaatggtgagacagagacgggtgtaaccctgcatcagatggtgaaaaaagcggat
gcaggaccgattgtcgggcagcataaagttatgattagtgggagcgatacggcattaact
ttgcatacaaaaatgcgtgatgctgccaatgaactactgcgtgatttgttgccgaaaatg
aaaaatgcttcattgccactggagccacaaaaagaatctgaagcgagctgttttggtcgt
cgtacggcagatgatggtgcaattgattggcagaaatcagcattagcaatcaataatttg
gtgcgcgctgtaacagagccttatcccggtgcattcagctatcttggacaacgtaaattg
attatttggcgctcgcagccactcgatgttgtccatagcaagttagccggtacagtgttg
tcaacatctccactggttgttgcatgtggtgacggtgcgctggaaattataacagggcaa
ggcgaggaggggctatatgttcaagggagccgcctggcacaagagatgggaattgtcact
ggtatccgtctaggcaataaaccaagtcagaaattgaaaaggcgcacacgcgtattaatc
ttgggcgtaaatggcttcattgggaaccatttaactgagcgtttgttacgcgataatcgc
tatgaagtttatggtttagatattggttctgatgccatctgccgttttctcgacaaccca
aatttccattttgttgagggggacatcagtattcattccgaatggattgaataccacatt
aaaaagtgtgacgttatcttacctttagttgctattgcgaccccaattgaatatacccga
aatccactgcgagttttcgaattggattttgaagaaaacctaaaaattgttcgtgattgt
gttaaatacaataagcgtattgtcttcccgtcgacgtcagaagtatatggcatgtgtgat
gataaagaattcgatgaggatagttcgcggcttattgttgggccaatcaataaacagcgt
tggatttactcggtctccaagcaattgctagaccgtgttatttgggcttatggcgcgaaa
gaaaatctgaaatttacattgttccgtccattcaattggatggggccacggttggataac
cttgatgccgctcgtattgggagttcccgcgccattacacagctcattttaaatctggtc
gaaggctcgccaattaaacttgtcgatggtggggagcaaaagcgctgctttaccgatatt
catgatggcatcgaagcactgttccgtattattgaaaaccgtgatggcgcttgtgatggg
caaataattaatatcggtaacccaacgaatgaagccagtattcgtgagttagctgaaatg
ctattaagatgttttgaaaagcatgagttacgccataatttcccgccgttcgctggtttt
aaggatattgaaagtagcgcatattatggaaaaggttatcaggatgtggaataccgtaca
cctagtatccgcaatgcgcgccgtattttagattggcagccagaaattgctttagagcaa
accgtcatggaaacattagacttcttcctacgtggcgtcgtacttgaacaaaatgtactt
gaacaaaatgtacttgaacaaaatgtacttgagcaaaatgtcattgagcaaagtaaaacc
tcgaaggatgagcatcacgtatga

DBGET integrated database retrieval system