KEGG   Yersinia enterocolitica subsp. enterocolitica 8081 (serotype 0 8): YE2194Help
Entry
YE2194            CDS       T00469                                 

Gene name
btuE
Definition
(RefSeq) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
yen  Yersinia enterocolitica subsp. enterocolitica 8081 (serotype 0:8)
Pathway
yen00480  Glutathione metabolism
yen00590  Arachidonic acid metabolism
yen01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:yen00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    YE2194 (btuE)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    YE2194 (btuE)
Enzymes [BR:yen01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     YE2194 (btuE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx Redoxin AhpC-TSA AHJR-like
Motif
Other DBs
NCBI-GeneID: 4715467
NCBI-ProteinID: YP_001006434
UniProt: A1JPQ6
Position
complement(2404331..2404885)
Genome map
AA seq 184 aa AA seqDB search
MSHSIYSIPVKTIESQSVNLEKYKGSVLLVVNVASQCGLTKQYEGLENLYKTYQQQGFEV
LGFPSNEFAGQEPGSDEEIQAFCRGTFGVDFPMFSKIEVNGPQRHPLYQHLIAAKPVAVK
PESSEFYQRLASKGREPKHAGDILWNFEKFLIGRDGTVLERFAPDMTPEDPILVNAITRA
LAAH
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgagtcattcaatttattccatcccagtaaaaacgattgaaagccaatccgttaacctg
gaaaagtataaaggatcggttttgctggtggtcaatgtggcttcccaatgcggtttaacc
aagcagtatgaagggttggaaaatttatacaaaacatatcagcaacagggttttgaagta
ttgggctttccaagcaatgagtttgcggggcaagagcccggcagcgatgaggaaatccag
gcattttgtcgtggaacttttggtgtcgatttcccgatgttcagcaaaatagaagtcaat
ggcccacaacggcatcctttataccaacatctaatcgcggccaaacctgtggcggtaaaa
cctgaaagcagtgagttctatcagcgcttagcaagtaaaggtcgcgagccaaaacatgcc
ggtgacattctgtggaactttgaaaaattcttgattggccgagatggtaccgttcttgaa
agatttgcacccgatatgacgccagaagacccgattttggtcaatgctattacacgcgca
ttggctgctcactaa

DBGET integrated database retrieval system