KEGG   Yersinia enterocolitica subsp. enterocolitica 8081: YE2214Help
Entry
YE2214            CDS       T00469                                 

Gene name
trpA
Definition
(RefSeq) tryptophan synthase subunit alpha
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
yen  Yersinia enterocolitica subsp. enterocolitica 8081
Pathway
yen00260  Glycine, serine and threonine metabolism
yen00400  Phenylalanine, tyrosine and tryptophan biosynthesis
yen01100  Metabolic pathways
yen01110  Biosynthesis of secondary metabolites
yen01130  Biosynthesis of antibiotics
yen01230  Biosynthesis of amino acids
Module
yen_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:yen00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    YE2214 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    YE2214 (trpA)
Enzymes [BR:yen01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     YE2214 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA NMO His_biosynth
Motif
Other DBs
NCBI-GeneID: 4715485
NCBI-ProteinID: YP_001006452
UniProt: A1JPY2
Position
2426027..2426833
Genome map
AA seq 268 aa AA seqDB search
MERYQQLFKQLAAKNEGAFVPFVQLGDPTPALSLEIIDTLIAAGADALELGIPFSDPLAD
GPTIQNAALRAFAAGVTPGICFEMLAEIRKKHPTIPIGLLMYANLVFHNGIDTFYQRCAD
VGVDSVLIADVPFEESLPFRTAALRHGIAPIFICPPNADDDLLREIASHGRGYTYLLSRA
GVTGAENHGQLPLNHLIDKLCEYNAAPALQGFGISEPEQVKISLAAGAAGAISGSAIVKI
IENNVSQPAEMLAQLANFVTNMKAATRS
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggagcgttatcaacagcttttcaaacagttggctgccaaaaacgaaggcgcatttgtt
cctttcgtgcaactcggcgacccaacaccagctctctccttagaaattatcgacaccttg
attgccgcaggcgctgatgcattggagttgggcattcctttctctgatccattggctgat
ggcccgacgatccaaaacgccgcactacgtgcttttgccgctggtgttacccctggtatc
tgttttgagatgctggcagaaatccgtaaaaagcaccctaccattcccattggattgctg
atgtatgcaaatctggtattccataatgggatagatactttctaccagcgctgcgctgat
gtcggtgtcgactcggtgctgattgctgatgtgccgtttgaagagtctctaccgttccgt
actgcggccttgcgccacgggattgcgcctatctttatctgcccgcctaatgccgatgat
gatttattgcgagaaatagcctctcatggccgtggctatacctatctgctctcccgcgcg
ggtgtgacgggggctgagaatcacggacagctgccattgaatcatttgatagataaactg
tgtgaatacaatgcggctccggctctacaaggttttggtatctcagaacctgagcaggta
aaaatcagtctggcggctggggcagcaggtgccatttcaggttctgctattgtaaaaatc
attgaaaacaatgtctcacagcccgcagagatgctcgcgcaattggccaacttcgtgacc
aatatgaaagcagccacccgcagctag

DBGET integrated database retrieval system