KEGG   Yersinia enterocolitica subsp. enterocolitica 8081 (serotype 0 8): YE2426
Entry
YE2426            CDS       T00469                                 

Name
(GenBank) conserved hypothetical protein
  KO
K03321  sulfate permease, SulP family
Organism
yen  Yersinia enterocolitica subsp. enterocolitica 8081 (serotype 0:8)
Brite
KEGG Orthology (KO) [BR:yen00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:yen02000]
    YE2426
Transporters [BR:yen02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   YE2426
SSDB
Motif
Pfam: Sulfate_transp STAS PhoR
Other DBs
NCBI-ProteinID: CAL12473
UniProt: A1JRS3
Position
2616627..2618324
AA seq 565 aa
MKTHGINGIRPFSAIIDACWRETYTLQRFIKDIIAGITVGIIAIPLAMALAIASGVPPQY
GLYTSAIAGIVIAVSGGSRYSVSGPTAAFVVILYPVSQQFGLAGLLLATLLSGVFLLCMG
LGRLGRLIEYIPLSVTLGFTSGIGITIATMQVKDFFGLHLPEVPETYVGKVAALAQALPT
INFSDTLIATVTLMVLILWPRLKLKLPGHLPALVAGTAVMAVLSLFDHQVATIGSRFGYL
LADGTQGHGIPPILPQFVLPWHLPAANGQEFVLNWATLSALLPAAFSMAMLGAIESLLCA
VVLDGMTGQKHHSNSELVGQGLGNMVAPFFGGITATAAIARSAANVRAGATSPVSAIIHA
LLVLLALLVLAPMLSYLPLAAMASLLLIVAWNMSEAHKVVDLLRRGPKDDIIVMLLCMSL
TVLFDMVIAITVGIVLASLLFMRRIARMTRLSEIPTEMNEHRLVLRVNGPLFFAAAERIF
NELLSRSENYDTIILQWDAVPVLDAGGLNAFLRFTEALGEHQQLIITDIPFQPLKTLARA
RVQPIEGKLSFYGSLPEALAALAAK
NT seq 1698 nt   +upstreamnt  +downstreamnt
atgaaaacgcacggaattaacggcattaggccgttcagcgcgattattgacgcttgctgg
cgagaaacctatacacttcaacgctttataaaagatataattgccggtattactgtcggc
attattgctattccactggctatggcactggcaattgccagtggtgttcccccacagtac
ggcttatatacctcggcaattgccgggattgttattgcggtcagcggcggctcccgttat
agcgtatctggccctaccgcagccttcgtggttattctttacccagtatcacaacaattt
ggtctggccggtttattactggcgacattgctttctggcgtgtttttattgtgtatgggg
ctgggcagattaggccgcttaattgaatatattccgctgtcagtcacgctcggctttacc
tcgggaattggtatcaccatcgccaccatgcaagtgaaagatttcttcggtctacacttg
ccggaagtgccggaaacttatgtgggcaaagtagcagcacttgcccaggcactgccaacc
atcaacttcagtgatacgttaattgcaactgtgactctgatggtattaattctctggcca
cgattaaaattaaagttaccgggtcacttacctgcactcgtcgctggtaccgctgttatg
gcagttttatcgttatttgatcatcaagttgccactatcggctcacgttttggctattta
ttggctgatggcacacaaggccacggtatcccccctattttgccgcaatttgtcttaccc
tggcatctccctgccgccaatgggcaagaatttgttttgaattgggcaacactttcggca
ctgctaccagcagccttttcgatggcgatgctcggggcgattgagtcgttattatgcgca
gtggttcttgatggcatgactgggcaaaaacatcattcaaacagtgagttagtcggtcag
gggctcggtaatatggtggcaccgttcttcggtggtatcaccgccactgcggctattgca
cgttcggcagctaacgtccgtgcaggagcaacctcaccggtgtcagcaattatccatgcc
ctactggtgttactggctttattggttttggcaccgatgttgtcatacctgccgctggct
gccatggcctccttgctgctcatcgtggcctggaatatgagtgaggcgcataaagtggtc
gacttactgcgccgtggccctaaagatgacattatcgtcatgctgttgtgtatgagtctg
acggtattattcgatatggtgattgctatcacggtaggaattgtattggcctcactgcta
tttatgcgccgtattgcccgcatgacccgtctaagtgaaattcctactgaaatgaatgaa
catcggctagtgttgcgcgttaatgggccactgttttttgccgccgcagagcggatattt
aacgaattactcagccgtagcgaaaattacgataccatcattctgcaatgggatgcagta
ccggttctggatgctgggggattaaatgcgtttctgcgcttcactgaggccttgggcgag
catcaacaactcattatcacggatattcctttccaaccgttaaaaacgctggcaagagcg
cgggtacaacctattgagggtaagttgagcttctacggctcactccctgaggctttggca
gcattagcggcaaaataa

DBGET integrated database retrieval system