KEGG   Yersinia enterocolitica subsp. enterocolitica 8081 (serotype 0 8): YE2689
Entry
YE2689            CDS       T00469                                 

Definition
(RefSeq) hypothetical protein
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
yen  Yersinia enterocolitica subsp. enterocolitica 8081 (serotype 0:8)
Pathway
yen03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:yen00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    YE2689
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:yen02044]
    YE2689
Secretion system [BR:yen02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YE2689
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-GeneID: 4713557
NCBI-ProteinID: YP_001006880
UniProt: A1JTM5
Position
complement(2921360..2921845)
AA seq 161 aa
MSQDMFIKIDGIEGESLDANHKNEIQVLAWKWDVSQHSNMHSGSGGGSGKATVSDFCFTH
YTDKASPNLLSYCLLGKHIKNIQFVLRKAGGDPLEYLTIKFTDVIITRVDMAGSLEDETR
PREEIRFSFTKMTQDYVMQNAEGHKSGVISANYDVKANQQS
NT seq 486 nt   +upstreamnt  +downstreamnt
atgtcgcaagatatgtttattaaaattgatggtatcgaaggcgaatctttagatgctaac
cacaaaaacgaaattcaggtgctggcttggaaatgggacgtttctcagcactcaaatatg
cacagtggctcaggcggcggttcaggtaaagcaactgtttctgacttctgtttcacgcat
tataccgataaagcaagcccgaacttattgagctattgcttgttgggtaagcatattaag
aatatccaattcgttctgcgtaaagcaggtggcgatccactggaatacctgactattaaa
tttaccgatgtaatcatcactcgtgttgatatggccggttctcttgaagatgaaactcgt
ccacgtgaagagattcgtttctcattcaccaagatgactcaagactacgttatgcagaat
gctgaaggccataaatctggcgttatttctgctaactacgatgttaaagctaaccagcaa
agctaa

DBGET integrated database retrieval system