KEGG   Yersinia enterocolitica subsp. enterocolitica 8081 (serotype 0 8): YE2690
Entry
YE2690            CDS       T00469                                 

Definition
(RefSeq) hypothetical protein
  KO
K11900  type VI secretion system protein ImpC
Organism
yen  Yersinia enterocolitica subsp. enterocolitica 8081 (serotype 0:8)
Brite
KEGG Orthology (KO) [BR:yen00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:yen02044]
    YE2690
Secretion system [BR:yen02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YE2690
SSDB
Motif
Pfam: VipB VipB_2 DUF1877
Other DBs
NCBI-GeneID: 4713558
NCBI-ProteinID: YP_001006881
UniProt: A1JTM6
Position
complement(2922177..2923604)
AA seq 475 aa
MTKEFKAKSEQTKAAVEGAVKTLAEQALANSVTVSDDAYKSIASIIAEIDSKLSEQINLI
LHHQEFQSLESAWRGLHYLVNNTETDEKLRLRFLDISKDELRRNMKRYKGVAWDQSPLFK
KVYEEEYGQLGGEPYGCLVADYYFDHTAPDVDLLASIGKVAASAHVPFITGAAPSVLQME
SWQELSNPRDLTKIFTQNLEYAAWNSLRQSEDSRYIGLAMPRFLARLPYGIRTNPVDAFH
FEETTDGADHGKYVWSNAAYAMAVNINRSFKEYGWCTLIRGVESGGVVEGLPCHTFPTDD
GGIDMKCPTEIAISDRREAELAKNGFIPLVHRKNTDYAAFIGAQSLQKPAEYYDSDATAN
ANLSARLPYLFACSRFAHYLKCIVRDKIGSFKERDEMQRWLNDWVMNYVDGDPANSSIET
KARRPLAAAEVIVEDVEGNPGYYQAKFFLRPHFQLEGLTVSLRMVAKLPSLKDVA
NT seq 1428 nt   +upstreamnt  +downstreamnt
ttgaccaaagaattcaaggctaagtctgagcagaccaaagcggcagtagaaggtgccgtt
aaaacattggctgagcaggcgctggctaattcggtaactgtatctgatgatgcttataaa
agcattgcctctattattgctgaaatcgacagtaaattgtctgagcagatcaatttgatc
ttgcatcatcaagagtttcagtctctggaaagtgcctggcgtggcctgcactatttagtg
aataacaccgagactgatgagaaattgagattacgttttctcgacatctctaaagatgaa
ttacgccgtaatatgaagcgttataaaggtgtggcgtgggatcagagcccattattcaaa
aaagtctatgaagaagagtatggccaattgggcggcgaaccttatggttgcctggtggcg
gattactactttgaccatactgcgcctgacgttgatttgctggcttccatcggtaaggtt
gctgcttctgcacacgtaccttttatcactggtgccgcgccgtcagtattgcagatggaa
tcctggcaagagctgtcaaatccgcgtgatttgaccaagatcttcactcagaatcttgag
tatgctgcctggaactcactgcgtcagtccgaagactcccgttatattggtctggcaatg
ccgcgtttcctggcgcgtctgccatacggtattcgcactaacccggtagatgccttccac
tttgaagagacgactgacggtgccgaccatggcaaatatgtgtggtccaacgcggcgtat
gctatggctgttaacatcaaccgttcattcaaagaatatggctggtgtaccctgattcgt
ggtgtggaaagtggtggtgtggtggaaggcttgccatgtcatacattcccaactgatgat
ggtggcattgatatgaagtgcccaacagaaatcgctatttctgaccgtcgtgaagcggaa
ttggctaaaaatggctttattccactggtgcacagaaaaaatactgattatgcggcattt
attggcgcgcaatcattgcaaaaacctgctgaatattacgattcagatgctacagctaac
gccaacttgtcggcacgtttgccttacctgttcgcctgttcacgttttgcccattacctg
aaatgtatcgtgcgtgacaaaatcggctcattcaaagagcgcgatgagatgcaacgctgg
ttgaacgattgggtcatgaactatgtagatggcgatccggcaaactcttctatcgagacg
aaagcacgccgtccgttggccgcagctgaagttattgttgaagatgttgaaggtaaccca
ggttattaccaggctaaattcttcctgcgcccacacttccaattggaaggtttgacggta
tcactgcgcatggttgctaaattaccttcactgaaagatgttgcgtaa

DBGET integrated database retrieval system