KEGG   Yersinia enterocolitica subsp. enterocolitica 8081: YE2924Help
Entry
YE2924            CDS       T00469                                 

Gene name
gpmA
Definition
(RefSeq) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
yen  Yersinia enterocolitica subsp. enterocolitica 8081
Pathway
yen00010  Glycolysis / Gluconeogenesis
yen00260  Glycine, serine and threonine metabolism
yen00680  Methane metabolism
yen01100  Metabolic pathways
yen01110  Biosynthesis of secondary metabolites
yen01120  Microbial metabolism in diverse environments
yen01130  Biosynthesis of antibiotics
yen01200  Carbon metabolism
yen01230  Biosynthesis of amino acids
Module
yen_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
yen_M00002  Glycolysis, core module involving three-carbon compounds
yen_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:yen00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YE2924 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    YE2924 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    YE2924 (gpmA)
Enzymes [BR:yen01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     YE2924 (gpmA)
Membrane trafficking [BR:yen04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    YE2924 (gpmA)
Exosome [BR:yen04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   YE2924 (gpmA)
  Exosomal proteins of melanoma cells
   YE2924 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-GeneID: 4714927
NCBI-ProteinID: YP_001007113
UniProt: A1JRT1
Position
3179811..3180563
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLVRHGESQWNNENRFTGWYDVDLSEKGRTEAKAAGKLLKDEGFTFDFAYTSVL
KRAIHTLWSILDELDQAWLPTEKTWKLNERHYGALQGLDKSETAAKYGDEQVKLWRRGFA
ITPPALDKSDERFPGHDPRYAKLTDAELPTTESLALTIDRVIPYWEEVIKPRIASGERVI
IAAHGNSLRALVKYLDNLNEEEILELNIPTGVPLVYEFDENFKPIKHYYLGNADEIAAKA
AAVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggcagtaacaaagctggttctggtacgtcacggcgaaagtcaatggaacaacgaaaac
cgcttcaccggttggtatgacgttgatttgtctgagaaaggccgtaccgaagcaaaagca
gctggcaagctgttgaaagatgaaggttttacttttgatttcgcctacacctcagtatta
aaacgcgctatccacaccttgtggagcatcctggacgaattggatcaggcttggcttcca
acggaaaaaacctggaaactgaatgagcgtcattacggcgcattgcaaggtttggataaa
tctgaaactgcggctaaatacggtgatgagcaagttaaactgtggcgtcgcggctttgcc
atcacccctccagcactggataaaagtgatgagcgcttccctggtcatgacccacgttat
gcaaaattaaccgatgcagaactgccaaccactgaaagcctggctctgactatcgatcgc
gttatcccttactgggaagaagtgatcaaaccacgcatcgccagtggcgagcgcgttatc
atcgctgctcacggtaactctttgcgtgcactggtgaaatatctggataatctgaacgaa
gaagaaattcttgagctgaatatcccaacaggtgtgccattagtgtatgagtttgacgaa
aacttcaaaccaatcaaacactactatttgggcaacgctgatgaaatcgcggctaaagct
gctgcggtggccaatcagggtaaagcgaagtaa

DBGET integrated database retrieval system