KEGG   Yersinia enterocolitica subsp. enterocolitica 8081 (serotype 0 8): YE3073Help
Entry
YE3073            CDS       T00469                                 

Gene name
manC
Definition
(RefSeq) mannose-1-phosphate guanylyltransferase
  KO
K00971  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
yen  Yersinia enterocolitica subsp. enterocolitica 8081 (serotype 0:8)
Pathway
yen00051  Fructose and mannose metabolism
yen00520  Amino sugar and nucleotide sugar metabolism
yen01100  Metabolic pathways
yen01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:yen00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    YE3073 (manC)
   00520 Amino sugar and nucleotide sugar metabolism
    YE3073 (manC)
Enzymes [BR:yen01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     YE3073 (manC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase MannoseP_isomer Cupin_2 NTP_transf_3 Peptidase_M10
Motif
Other DBs
NCBI-GeneID: 4714560
NCBI-ProteinID: YP_001007255
UniProt: A1JN58
Position
complement(3342603..3344000)
Genome map
AA seq 465 aa AA seqDB search
MLLPVIMAGGAGSRLWPLSRTHYPKQFLALTSELSMFQETLLRLGNLPHLSPLVICNAEH
RFIIAEQLRQQNLLHSGIVLEPIGRNTAPAIALAALLATSNGEDPILLVLAADHVIQDKP
AFISAIQLAEPLAEMGKLVTFGIVPNTPETGYGYIRQGKQIEGGAFQVDSFVEKPDLAKA
EQYLSSGDYYWNSGMFVFKASRYLQELEKHRPDIFEACKSAIAGQRKDLDFIRLDEAAFY
SCPDESIDYAVMERTSDAVVVPMNAQWSDVGCWSALWEINDKDSHGNVVRGDVLTEDTNN
SYIYSQNRLVATVGINDLIIVETKDALLVANKNKVQSVKEIVGQLKLGSRLEYLQHKEVY
RPWGSHDAIAEGVRYHVQHVTIKPGQRTATQIHHHRAEHWVVVSGTARVYRDNESYLVTE
NESTYIAVGVAHSIENPGKLPLEIIEVRTGSYLEEDDIVRIEHKI
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgctattacctgtaattatggctgggggggctggcagccgcttgtggccgctatctcga
acccattaccccaagcaattcttggctcttacgtcagagttgagtatgttccaagaaacc
ttacttagattgggaaatctcccccatctttcaccattagtgatatgtaatgcagaacat
aggtttattattgctgagcaacttaggcagcaaaatttattgcatagcggcatagtattg
gagcctattgggcgtaatacagcacctgcaattgccttggctgcgctacttgccacatca
aatggtgaggacccgatattattggtactagcagctgatcatgtcatacaggataagcct
gcattcattagtgctattcaacttgcagagcctcttgcagaaatgggtaagttggtcact
tttggaatagttcctaatacacctgaaactgggtatggctatatccgacaaggtaagcag
atcgaaggaggagcttttcaggttgactcttttgtcgagaaacctgatttagccaaagca
gagcaatatttatcatctggtgattattactggaatagtgggatgtttgtattcaaagca
tctcgttatttgcaagagttggaaaagcatcggccagatatttttgaagcctgtaaaagt
gccattgccggacaacgcaaggatctagattttattcgccttgatgaggctgcattttac
agctgtcccgatgagtccatcgattatgcagtcatggaaagaacaagcgatgctgtcgtg
gttccgatgaatgcgcaatggagtgatgtcgggtgttggtctgcgctctgggaaatcaat
gataaagatagccatggtaatgtggttcgtggcgacgtattaacggaagatacaaacaat
agctatatctactctcagaatagattagtagccactgtcggtattaatgatttaattatt
gtcgaaaccaaagatgctttattggtggcgaataagaataaagttcaaagcgttaaagaa
atcgttgggcaacttaaacttggctcgcgacttgaatatctccagcataaggaagtctat
cgaccttgggggtcgcatgatgcgattgctgaaggtgtccgatatcatgtacagcatgta
acaatcaaaccgggacaacggactgcgactcaaattcatcatcatcgagctgaacactgg
gttgtcgtctctgggacggccagagtatatagagacaacgaaagttatttagtgacagag
aatgagtcaacctatattgctgttggagtggctcactctattgagaatccaggaaaactt
cctctggaaattatagaggttcgtactggaagttacttagaagaagatgatattgttcga
attgagcataaaatatag

DBGET integrated database retrieval system