KEGG   Yersinia enterocolitica subsp. enterocolitica 8081: YE3416Help
Entry
YE3416            CDS       T00469                                 

Gene name
tkt
Definition
(RefSeq) transketolase
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
yen  Yersinia enterocolitica subsp. enterocolitica 8081
Pathway
yen00030  Pentose phosphate pathway
yen01100  Metabolic pathways
yen01110  Biosynthesis of secondary metabolites
yen01120  Microbial metabolism in diverse environments
yen01130  Biosynthesis of antibiotics
yen01200  Carbon metabolism
yen01230  Biosynthesis of amino acids
Module
yen_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
yen_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:yen00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    YE3416 (tkt)
  Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    YE3416 (tkt)
Enzymes [BR:yen01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     YE3416 (tkt)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transketolase_N Transket_pyr Transketolase_C DXP_synthase_N TPP_enzyme_C
Motif
Other DBs
NCBI-GeneID: 4713808
NCBI-ProteinID: YP_001007582
UniProt: A1JPR2
Position
complement(3730171..3732165)
Genome map
AA seq 664 aa AA seqDB search
MSSRKELANAIRALSMDAVQKANSGHPGAPMGMADIAEVLWRDYLNHNPTNPHWADRDRF
VLSNGHGSMLIYSLLHLTGYDLPMEELKNFRQLHSKTPGHPEYGYTAGVETTTGPLGQGI
ANAVGFAIAERTLGAQFNRPGHDIVNHHTYAFMGDGCMMEGISHEVCSLAGTMKLGKLTA
FYDDNGISIDGHVEGWFTDDTAARFEAYGWHVVRGVDGHNADSIKAAIEEAHKVTDKPSL
LMCKTIIGFGSPKKAGTHDSHGAPLGADEVAATREALGWKYAAFEIPQDIYAAWDAKEAG
KAKEAAWNEKFAAYAKAYPELAAEFKRRVSGELPANWATESKKFIEELQANPAKIASRKA
SQNALEAFGKVLPEFLGGSADLAPSNLTIWSGSKSLSDDQAGNYIHYGVREFGMSAIMNG
IALHGGFIPYGATFLMFVEYARNAVRMAALMKIRSIFVYTHDSIGLGEDGPTHQPVEQMA
SLRVTPNMSTWRPCDQVESAVAWQYALERKDGPSALIFSRQNLAQQPRTAEQLANISKGA
YVLKDCAGQPELIFIATGSEVELAVAAADQLTAAGRKVRVVSMPSTDAFDKQDAAYRESV
LPSAVSARVAVEAGIADYWYKYVGLNGAVVGMHSFGESAPAELLFKEFGFTVENVVAKAQ
ALLK
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atgtcctctcgtaaagagcttgccaacgcgatccgcgcattaagcatggacgcagtgcaa
aaagcgaattccggccaccccggcgcccctatgggcatggcagatattgccgaagtactg
tggcgtgattacctgaaccataatccaactaatccacactgggctgaccgcgaccgtttc
gtcttgtcgaatggtcacggctccatgttgatctatagcctgctgcatctcactggttat
gatctgccaatggaagaactgaaaaacttccgtcagttacactctaaaacgccaggtcac
cctgaatatggttataccgctggcgtagaaaccaccactggcccattgggtcagggcatt
gccaacgcagtgggttttgcgattgcagaacgcacactgggcgcgcagtttaaccgccca
ggccatgatatcgttaatcaccacacttatgcctttatgggtgatggctgcatgatggaa
ggcatctctcatgaagtttgctcactggctggtaccatgaagctgggtaaactgactgca
ttctatgatgacaacggtatctctatcgacggccatgttgaaggctggttcactgatgac
accgctgctcgtttcgaagcttacggttggcatgtggttcgtggtgttgatggtcataac
gctgactccatcaaagcggccatcgaagaagcccacaaagttaccgacaaaccatcactg
ctgatgtgcaaaaccattatcggttttggttcaccgaagaaagccggcacccacgattca
catggcgcaccattaggcgctgacgaagttgccgctacccgtgaagcattgggttggaaa
tacgcagcattcgaaattccacaggatatttatgccgcgtgggatgctaaagaagctggt
aaggcaaaagaagctgcctggaatgagaagttcgctgcttacgctaaagcgtatccggag
ctggccgctgaattcaaacgccgcgtcagcggtgagttgccagccaactgggcgactgaa
tccaagaaatttattgaagagttacaagccaatcctgccaaaattgctagccgtaaagca
tcacaaaatgcgctggaagctttcggtaaagtgttgcctgaattcctcggtggctccgcc
gatctggcaccaagtaacctgactatctggtctggctctaaatctctgagtgatgaccaa
gcgggtaactacattcactacggtgtgcgtgaatttggtatgtcagccatcatgaatggt
attgctctgcacggaggtttcatcccttacggcgcaaccttcctgatgtttgtggaatat
gcccgtaacgcggtacgcatggccgcgctgatgaaaatccgcagcatctttgtttacacc
catgactctatcggtctgggcgaagatggcccaacccatcagccagttgagcagatggcc
agcttgcgtgtgacaccaaatatgagcacctggcgcccatgtgaccaggttgagtctgcg
gtagcgtggcaatatgcgctggaacgtaaagacggcccaagcgcacttatcttctctcgt
cagaacctggcgcaacagccacgtactgctgagcagttagccaatatctctaaaggcgca
tatgtgctgaaagattgtgccggccagcctgaactgatctttattgctaccggttctgaa
gttgaattggcggttgctgctgctgaccaactgactgctgctggccgtaaagtgcgcgtt
gtgtctatgccatcgaccgatgcattcgacaaacaagatgcggcttaccgtgaatctgta
ttgccatctgcggttagcgcgcgcgttgcagttgaagcgggtattgctgattactggtac
aaatacgtcggtctgaatggcgcagtggtggggatgcacagctttggtgaatctgctcca
gctgaattgctgttcaaagagtttggtttcaccgtagaaaacgtggtggccaaagctcaa
gcgttgttgaaatag

DBGET integrated database retrieval system