KEGG   Yersinia enterocolitica subsp. enterocolitica 8081 (serotype 0 8): YE3467
Entry
YE3467            CDS       T00469                                 

Definition
(RefSeq) hypothetical protein
Organism
yen  Yersinia enterocolitica subsp. enterocolitica 8081 (serotype 0:8)
SSDB
Motif
Pfam: TraU
Other DBs
NCBI-GeneID: 4713858
NCBI-ProteinID: YP_001007628
UniProt: A1JPY8
Position
complement(3780765..3781718)
AA seq 317 aa
MILSSLRYRRLLPLILLVGSSQCMASVNTASLIASAASASCISWKVKGICYWLLCTPLGC
SVKTSVKVEHFTPQVVVSAYNGSGDNPWMEMAAVSRAASGVESGITGMFTGGGQQQMKAP
GLRQQNLRYHYADAYGHPATSLMGGHIAGYSCRSAATPFAPYFVSALDALVWRSGLPESL
YPEALIPGQRELGRQSNANMWGNIYPRSGFVTQQDSYKSAAVVAQRVADIITRYGQLHVY
QPLVGQSSLGYWPPESVRENTGNQNHKWQRLEPRLSTTCAIFPDANGPIAQDGNYAWALW
QPYSCCKRRGQTLLLPH
NT seq 954 nt   +upstreamnt  +downstreamnt
atgatcctctcatctttacgctatcggcgattattaccgctcattcttttggtgggtagc
agtcagtgtatggcgagcgtcaacacagcaagcctgattgctagtgcggccagcgcttcg
tgcatcagttggaaagtaaaaggcatctgctactggttgttgtgtacgcctttgggttgc
tcagtgaaaacctctgtcaaggtcgaacattttactccccaagttgtggtctccgcgtac
aacggttccggcgataatccttggatggagatggctgctgtcagcagagccgccagtggg
gttgaaagcggtattacgggtatgtttactggcggtggtcaacagcaaatgaaggcacct
ggcttacgtcaacagaacctgcgctaccattatgcagatgcctatggacatccggcgacc
tcgctgatgggggggcatattgcaggctattcctgccgttcagccgccactccttttgcc
ccttattttgtcagtgccctcgatgctttggtatggcgcagtggtttgcctgaatctctc
tatccagaagcactcatccccgggcaacgtgaactgggtcgccagtcaaacgccaatatg
tgggggaatatttaccctcgtagtggttttgttacccagcaagatagctataaatccgct
gcggtagtcgcccagcgggttgccgatatcattacccgttatggtcaactgcatgtttat
caacccttggttggccaatcttcgctgggctattggccacccgaatcggttcgtgagaat
accggtaatcagaatcataaatggcagcgtctggagccccgactctcaacgacctgcgct
atttttccagatgctaatggccccatcgctcaggatggtaactatgcctgggcactttgg
caaccttacagttgctgtaagcgacgtggacaaaccttactcttacctcactga

DBGET integrated database retrieval system