KEGG   Yersinia enterocolitica subsp. enterocolitica 8081 (serotype 0 8): YE3485
Entry
YE3485            CDS       T00469                                 

Definition
(RefSeq) hypothetical protein
Organism
yen  Yersinia enterocolitica subsp. enterocolitica 8081 (serotype 0:8)
SSDB
Motif
Pfam: DUF3438
Other DBs
NCBI-GeneID: 4713874
NCBI-ProteinID: YP_001007644
UniProt: A1JQ08
Position
complement(3797961..3798827)
AA seq 288 aa
MKPNVLVAVVFMMMPVVVSAVELMKWERIPLQIPLNVGQERIVFVDKNVRVGFPPTLNGK
LRVQSSGGAVYLSASETFPVTRLQLQNKANGEIILLDVSATAGKSIREPVQLVYDGEVSS
ASTSDKTRISGNEQTAAISERRKPAKLNTPLPVVLTRYAAQSLYGPLRTVEPVVGITNTA
LKLPSRLTTLYPSEPVEVSPLVGWSLNGYSVIALLVRNTATVNVILNPRMLQGEFISAAF
QHPWLGSAGMPEDTTVLYLVVRGRPEGAFRSESMTVTDKTHQTRGAPK
NT seq 867 nt   +upstreamnt  +downstreamnt
gtgaagccgaacgtcttggtagccgtggtattcatgatgatgcccgttgtagtcagcgct
gttgaattgatgaagtgggaacgcattcccttgcagataccgctgaacgtagggcaggag
cgtattgttttcgtcgataaaaatgtgcgagtgggttttcctcctactctgaacggtaaa
ttacgggtgcagagcagcggaggcgctgtttaccttagcgccagcgagactttccctgtg
acccgcctgcaactacaaaacaaggcaaacggagagattattcttcttgatgttagcgcc
acagcgggtaagtcaattcgggagcctgttcaactggtctatgacggtgaagtatcttct
gcttctaccagtgataaaactcggattagcggtaacgagcaaacagcagcgatatccgag
cggcgtaagccagcaaagctgaatacgccgttaccggtggtcttgacgcgctatgccgcg
caaagtttatatggtccattgcgcacggttgaacctgttgtgggcatcacgaacacggcg
ctcaaacttccttcacggctgaccactctgtatccctcggaacccgtcgaggtgagtcct
ctggtgggctggagcctcaatggctacagcgttatcgcattactggtgcgtaataccgcc
acggttaacgtcattctgaaccctcgaatgttgcagggagagttcatttctgccgctttc
cagcacccttggttaggcagtgcgggaatgccagaagatacaaccgtattgtatctggtt
gttcgagggcgtcctgagggagcatttagatctgaatccatgacggtaacggacaagact
caccaaacgcggggagcgcctaaatga

DBGET integrated database retrieval system