KEGG   Yersinia enterocolitica subsp. enterocolitica 8081 (serotype 0 8): YE3493Help
Entry
YE3493            CDS       T00469                                 

Definition
(RefSeq) TraG-family protein
Organism
yen  Yersinia enterocolitica subsp. enterocolitica 8081 (serotype 0:8)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TrwB_AAD_bind TraG-D_C T4SS-DNA_transf DUF87 FtsK_SpoIIIE
Motif
Other DBs
NCBI-GeneID: 4713881
NCBI-ProteinID: YP_001007651
UniProt: A1JQ16
Position
complement(3802434..3804554)
Genome map
AA seq 706 aa AA seqDB search
MSDRYVMESLLRPAVELYTATTAWSTVYVCLTAPWAVALAPSVSWVTAAGFGVLALKRTH
QGLRILRYRRNIRRMPRYAMSSRQIPISHRYLFLGRGFQWTQKHTQRLLEARRPETEHYV
QPSLTYRMARYLEKRLESSLPWLCRLTQADTCLNPVRPLPPVGGSPIYHGVELNERNVLY
DLGERVGHTLVIGTTRVGKTRLAEVMITQDIRRGDVTVMFDPKGDADLLKRMWAETRRAG
RENEFYVFHLGWPDISARYNAIGRFSRISEVASRVAGQLSGEGNSAAFREFAWRFVNIIT
RALVALGQRPDYGLILRYVTNIGELYETYVENLLTVQAPQLWLNVQNVISSNMLKERDLP
RNMQGQANAMKVWAIETVLSSDAGKKLWDPVLDGLRSAVRYDRTYFDKIVASLLPLLEKL
TTGKTAALLAPDYNDMNDTRPIFDWQEVIRKKGIVYVGLDALSDPEVASAVGNSMFADLV
SVAGHIYKFGISDEIGAKTQKKVPINLHCDEFNELMGDEFIPLINKGGGAGIQVTAYTQT
LSDIEARVGSSAKAKQVVGNFNSLIMLRVRENSTAELLTSQLPEVDVYTKTLVSGVTDMT
NPEQDSDFTSNVQDRVSSIRMPMVTPADIINLPKGQAFALLEGGQLWKIRMPLPDGSNDQ
LMPESISRIAEYMQQNYRTGENWWLGSALPSDILAASAFSQGDAEN
NT seq 2121 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacaggtatgtgatggaatccctattgcgtcccgccgtcgagttgtacacggca
accacggcgtggagtaccgtttacgtttgcctgacagcaccttgggcggtggcattggca
ccgtctgtcagttgggtgacggcggctggctttggtgttcttgctttgaaacgaacccac
caagggctgcgtattctgcgctatcggcgcaacatccggcggatgccccgttatgcaatg
agtagccgacaaatccccatcagccaccgatatctgtttctggggcgcgggtttcagtgg
acacaaaaacacactcagcgcctgctggaggcgcgccgtccagagaccgaacattatgtg
cagccatcgctcacctatcgtatggctcggtatttggaaaaacggctggagtccagcttg
ccatggctgtgtcggctgacgcaggccgatacttgtttaaatccagtaagaccgctgccg
cctgtcgggggcagcccaatctatcacggtgttgaattaaatgaacgtaacgttctgtat
gacttgggagaacgtgttggccacacactggttatcggtaccacccgcgtgggaaaaact
cgtttagctgaggttatgatcacgcaggatatccgtcgcggggatgtgacagtcatgttc
gaccccaaaggggacgcagatctgcttaaacgtatgtgggcggaaacgcgtagagcgggg
cgtgagaatgagttctatgtattccacttgggctggccagatattagtgcccgttacaat
gccattggtcgcttcagccggatctctgaagtcgcttcacgcgtggccgggcaattatcc
ggtgaaggtaattcagccgcgtttcgtgaattcgcctggcgctttgtgaacatcattacc
cgggcattagtcgcccttgggcagcgccctgattacggactcatcctgcgctatgtgacc
aatattggcgaactttatgagacttatgtagaaaacctgctaaccgtacaagcccctcag
ctctggctgaatgttcagaacgtgatcagttcgaacatgctgaaagagcgtgatcttccc
cgaaatatgcagggccaggccaatgccatgaaagtgtgggcgatcgagacggtactcagc
agtgatgccggcaagaaattgtgggatccagtgctggatggtctacgcagtgcggttcgt
tatgatcgtacctattttgacaagatcgtggcttcgttactgccactgttggaaaaactc
actaccggtaaaaccgcggctctgctggcacctgattacaatgatatgaatgatacgcgg
ccgatttttgactggcaggaagtgatccgtaaaaaggggattgtgtatgttggtctcgat
gcactgtctgatcctgaagtggcgtcagcggtgggcaacagtatgtttgctgatctggtc
tcagttgcgggccatatctacaaatttggtatcagtgatgaaattggcgctaaaacgcag
aagaaagtgccgattaacctgcattgcgacgagttcaacgagttgatgggggatgagttc
atcccattaattaacaaagggggcggggcaggtatccaggtgacggcgtacactcagacg
ctttcagacattgaagcgcgagtgggcagtagtgctaaagcgaagcaggttgttggtaat
ttcaactccctgattatgctaagggtacgtgaaaacagtaccgccgaactgctgaccagc
caactgccggaagtcgatgtttatactaaaacgttggtctcaggtgtaacggatatgact
aaccctgagcaggattccgatttcaccagtaatgtacaagaccgtgtgagtagcatccgt
atgcccatggtcacgccagcagatattatcaacctgcccaaaggtcaggcgtttgcactg
ctcgaaggtgggcaactgtggaagatcagaatgcctcttcctgatggtagcaatgatcag
ttgatgccggaaagcatcagccggatagccgagtatatgcagcagaattaccgtactggg
gaaaattggtggttggggagtgcgctaccgtccgatattttggccgcgtcagcttttagt
caaggggacgctgaaaattaa

DBGET integrated database retrieval system