KEGG   Yersinia enterocolitica subsp. enterocolitica 8081 (serotype 0 8): YE3494A
Entry
YE3494A           CDS       T00469                                 

Definition
(GenBank) conserved hypothetical protein
Organism
yen  Yersinia enterocolitica subsp. enterocolitica 8081 (serotype 0:8)
SSDB
Motif
Pfam: SLT Glucosaminidase
Other DBs
NCBI-ProteinID: CAL13514
UniProt: A1JQ28
Position
complement(3805258..3805806)
AA seq 182 aa
MQTIPSIYREIAAEARVPAEFLYSLALVESSRRFKGGERPWPWTINVAGKGYHYETREDA
WQALLRFVRQAPLKRIDVGIAQINLGWNGHFFPSFYDVFDPNTNLRVAAQILRICYENRA
GSWINAAGCYHHPAGGKPAANYIAIVRRKLGTLAPVHITVSSKTTISDVTSVNHSLIWIE
PK
NT seq 549 nt   +upstreamnt  +downstreamnt
ttgcagacaatcccctcgatatacagagaaatcgccgctgaagcccgagtgccagcagag
ttcttatactcgctggcactggttgaaagttcacggcgctttaagggcggggagcgtccg
tggccatggacgattaacgtggcaggaaaagggtatcattatgaaacccgagaggatgca
tggcaggcactactcagattcgttcgccaagcgccactgaagcgtattgacgtgggtatt
gctcagatcaatttgggttggaatggccattttttcccttctttttatgatgtttttgac
cctaacaccaatttgcgtgtcgctgcgcaaatccttcgtatctgctatgaaaatcgtgcg
ggtagctggataaacgcggcaggctgctatcaccatcctgccggtggaaaacccgctgct
aactatatcgccattgtgcgtcgcaaattaggtaccctggctccagtacacattaccgta
tcaagcaagacgacgatctctgatgttacatcggttaaccactcactcatctggattgag
ccaaaatga

DBGET integrated database retrieval system