KEGG   Yersinia enterocolitica subsp. enterocolitica 8081 (serotype 0 8): YE3495
Entry
YE3495            CDS       T00469                                 

Definition
(RefSeq) hypothetical protein
Organism
yen  Yersinia enterocolitica subsp. enterocolitica 8081 (serotype 0:8)
SSDB
Other DBs
NCBI-GeneID: 4713884
NCBI-ProteinID: YP_001007654
UniProt: A1JQ29
Position
complement(3805875..3806642)
AA seq 255 aa
MNRSPCFTPQKAQLLKCLPYTVVTLVLVICLGSAYANLASSVTDYSSALETLQEKSAQLQ
PRQNPQQWGLSDVEWQKYLQLQQGKRGVQSPGLDPLTMLGVESEMPAERRRLAELWVKEE
YQRTEKELAFQREVNAAWNRLYSGVLSVNRGSAAGIVPNGRGRLALFVRDNCVRCDVRLA
ALLTDKSAVDIYLVGSDGKDGSVRQWAVSRNIPVDRVKAGQVTLNHDRGLWRQYGQGQMP
VVLQKGENGWLIAAF
NT seq 768 nt   +upstreamnt  +downstreamnt
ttgaatcgctctccatgctttacgcctcaaaaagctcaattactgaaatgccttccttat
actgttgtaacactggttttagtcatctgtttggggtctgcctacgcgaatttggcaagt
agtgtcacggattacagttcagcacttgaaacgttacaggaaaaatcagcacagcttcag
cccaggcagaacccccagcagtgggggctaagtgatgttgaatggcaaaagtatctgcaa
ttacagcaaggtaagcgtggcgtacagtcaccgggacttgatcctctgacgatgcttggt
gtggaaagtgaaatgccagcagaacgtcgtcgtttggcggaactttgggtgaaagaagaa
tatcagcggacagagaaagaactggcatttcaacgtgaggtcaacgccgcctggaatcgt
ctctattcgggtgtgttgtccgtaaatagggggagtgcggccggaatcgtaccaaatggc
cgtggtcggctggcgttgtttgtccgtgataactgcgttcgttgtgacgtcaggctggct
gcacttctcaccgataagagtgccgttgatatttacctggtaggcagcgacggaaaagat
ggctcagtacgtcaatgggctgtcagccgcaatattccagtggatagagtaaaggctggg
caggtcactctgaatcacgatcgcggtttatggcgacaatacggccaaggccaaatgccc
gttgttttgcagaaaggggagaatggatggctaatcgcagcattctga

DBGET integrated database retrieval system