KEGG   Yersinia enterocolitica subsp. enterocolitica 8081 (serotype 0 8): YE3882Help
Entry
YE3882            CDS       T00469                                 

Gene name
metA
Definition
(RefSeq) homoserine O-succinyltransferase
  KO
K00651  homoserine O-succinyltransferase/O-acetyltransferase [EC:2.3.1.46 2.3.1.31]
Organism
yen  Yersinia enterocolitica subsp. enterocolitica 8081 (serotype 0:8)
Pathway
yen00270  Cysteine and methionine metabolism
yen00920  Sulfur metabolism
yen01100  Metabolic pathways
yen01110  Biosynthesis of secondary metabolites
yen01130  Biosynthesis of antibiotics
yen01230  Biosynthesis of amino acids
Module
yen_M00017  Methionine biosynthesis, apartate => homoserine => methionine
Brite
KEGG Orthology (KO) [BR:yen00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    YE3882 (metA)
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    YE3882 (metA)
Enzymes [BR:yen01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.31  homoserine O-acetyltransferase
     YE3882 (metA)
    2.3.1.46  homoserine O-succinyltransferase
     YE3882 (metA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTS
Motif
Other DBs
NCBI-GeneID: 4714717
NCBI-ProteinID: YP_001008027
UniProt: A1JRX9
Position
complement(4237881..4238810)
Genome map
AA seq 309 aa AA seqDB search
MPIRVPDELPAVSFLRNENVFVMTSSRAKTQEIRPLKVLVLNLMPKKIETENQFLRLLSN
SPLQIDIQLLRIDSRESKNTPAEHLNNFYCDFEDIQEQNFDGLIVTGAPLGLVDFCDVAY
WPQIERIIAWAKDHVTSTLFVCWAVQAALNILYGIPKMTRETKLSGIYQHQTDKPLALLT
RGFDETFLAPHSRYADFPVELLQQYTDLDILVSSEEAGAYLFASKDKRVAFVTGHPEYDV
DTLAGEYQRDLAAGLNPQIPLNYFPNDDASLPPKASWRSHGHLLFANWLNYYVYQITPFD
LRHMNPTLD
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgccaattcgggttcctgatgaattaccagcagtgagttttttacgtaatgagaatgtg
tttgtcatgacctcatcgcgtgcaaaaactcaggaaattcgtcccctgaaggtgttggtt
ttaaatctgatgcctaaaaaaattgagacggaaaatcaattcctgcgtttactctccaac
tcacccctacagatcgatattcaattgttgcgaattgatagtcgcgaatcaaaaaatacg
ccagctgagcacctgaacaacttttattgtgattttgaagatattcaggagcaaaatttt
gacgggttgattgtgacaggggctcctctgggcttggtcgatttctgtgatgttgcttat
tggccgcaaattgagcgtattattgcctgggcaaaagatcatgtaacctcaactttattc
gtgtgttgggcggtacaggcagccttaaatatcttatacggtattcctaaaatgacgcgt
gagactaagctctcaggcatttaccagcatcaaacagataaaccactggcactactcaca
cgtggttttgatgagacattcctggccccacactctcgttatgccgatttccccgttgag
ctacttcagcaatacactgatctggatattctggtttcctcggaagaggccggtgcatat
ttgtttgccagtaaagataagcgagtcgctttcgtcaccggtcatcctgaatatgatgtc
gataccttagcgggagaatatcaacgtgatctggctgccggtctgaatccacaaatccca
ctcaattatttccccaatgatgatgcttcattacccccaaaagcatcctggcgtagccac
ggacatctgttatttgctaactggttgaactactacgtttaccaaatcacaccatttgat
ttacgtcatatgaatcctactctcgactaa

DBGET integrated database retrieval system