KEGG   Yersinia enterocolitica subsp. palearctica 105.5R(r): YE105_C0609Help
Entry
YE105_C0609       CDS       T01480                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
yep  Yersinia enterocolitica subsp. palearctica 105.5R(r)
Pathway
yep00260  Glycine, serine and threonine metabolism
yep00750  Vitamin B6 metabolism
yep01100  Metabolic pathways
yep01110  Biosynthesis of secondary metabolites
yep01120  Microbial metabolism in diverse environments
yep01230  Biosynthesis of amino acids
Module
yep_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:yep00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    YE105_C0609
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    YE105_C0609
Enzymes [BR:yep01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     YE105_C0609
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N
Motif
Other DBs
NCBI-ProteinID: ADZ41107
Position
719466..720755
Genome map
AA seq 429 aa AA seqDB search
MKLYNLKDHNEQVSFAQAIKQGLGKQQGLFFPLELPEFELTEIDKLLDLDFVTRSSRILS
AFIGNEIAPEVLTKRVQAAFEFPAPVAQVENDIAALELFHGPTLAFKDFGARFMAQMLAE
VAGDQPVTILTATSGDTGAAVAHAFYGLKNVRVVILYPRGKISPLQEKLFCTLGGNIHTV
AIEGDFDACQALVKQAFDDEELKQALSLNSANSINISRLLAQICYYFEAVAQLPQDARNQ
LVISVPSGNFGDLTAGLLAKSLGLPVKRFIAATNANDTVPRFLVNGQWQPKPTVATLSNA
MDVSQPNNWPRVEELYRRKIWQLKELGHGAVSDDITKDTMRELAELGYISEPHAAIAYRV
LRDQLQDGEFGVFIATAHPAKFKESVEEILAQELPLPKPLAVRAQLPLLSHDLPADFAQL
RTFLMALPK
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgtataaccttaaagatcacaacgagcaggtcagcttcgcgcaagcgattaaa
cagggcctgggcaagcagcaagggttgttcttcccgctggagttgccagagtttgaactg
acagaaattgataaactgctggatctggattttgtcactcgtagcagccgtattctttct
gcttttattggtaatgaaattgcaccagaggtgttaaccaaacgcgttcaggcggcgttt
gagtttccggctccggtcgctcaggttgagaatgatatcgccgcactggagttgttccac
ggcccgacattggcctttaaggacttcggcgcacgttttatggcacaaatgctggccgaa
gtggctggcgaccagccagtgactatcttaaccgcaacctctggtgatactggggcggcg
gtcgctcatgctttctatggcttgaaaaatgtccgcgtggttatcctctatccacgcggc
aaaatcagcccgctgcaagagaagctgttctgtacgttaggtggcaatatccacacggtg
gctattgagggcgattttgatgcttgtcaggcgctggtcaaacaagcctttgatgatgag
gagttaaagcaggcgctgagccttaactctgctaactccattaatatcagccgcttgctg
gctcaaatttgctattacttcgaagctgtagcccagttaccgcaagacgcgcgtaaccaa
ttggttatctccgtgccaagtggcaacttcggtgatttgaccgccggtttgctggcaaaa
tcgttaggtttgccggtaaaacgctttatcgctgccactaatgccaacgacaccgtgccg
cgcttcctggttaacggccagtggcagccgaagccgacggtggcgacgttatcgaatgct
atggatgtcagccagccgaataactggccgcgtgttgaggagctttatcgccgtaaaatc
tggcagttgaaagaattgggccacggcgcagtcagtgatgatatcaccaaagacaccatg
cgcgaattggcggagttagggtatatctcagagcctcatgctgctattgcctatcgtgtg
ttgcgcgatcaattgcaggacggagaattcggggtatttatcgcgacagcgcatccggcg
aaattcaaagaaagtgtagaagagattctggcgcaggaattgccactgccaaaaccactg
gcggtgcgagcgcaattgccattgttatcccatgatttaccagcagattttgcacaatta
cgcactttcttgatggcgttaccgaaataa

DBGET integrated database retrieval system