KEGG   Yersinia enterocolitica subsp. palearctica 105.5R(r): YE105_C0764Help
Entry
YE105_C0764       CDS       T01480                                 

Definition
(GenBank) ribose-5-phosphate isomerase A
  KO
K01807  ribose 5-phosphate isomerase A [EC:5.3.1.6]
Organism
yep  Yersinia enterocolitica subsp. palearctica 105.5R(r)
Pathway
yep00030  Pentose phosphate pathway
yep01100  Metabolic pathways
yep01110  Biosynthesis of secondary metabolites
yep01120  Microbial metabolism in diverse environments
yep01130  Biosynthesis of antibiotics
yep01200  Carbon metabolism
yep01230  Biosynthesis of amino acids
Module
yep_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
yep_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:yep00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    YE105_C0764
Enzymes [BR:yep01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.6  ribose-5-phosphate isomerase
     YE105_C0764
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rib_5-P_isom_A DeoRC RNase_PH_C
Motif
Other DBs
NCBI-ProteinID: ADZ41260
Position
complement(901742..902404)
Genome map
AA seq 220 aa AA seqDB search
MTQDELKKAVGWAALEYVKPGTIVGVGTGSTAAHFIDALASIKGQIEGAVSSSDASTAKL
KSYGIQVFDCNEVDELDIYVDGADEINSQMQMIKGGGAALTREKIIAAIARKFICIADAS
KQVDVLGKFPLPVEVIPMARSYVARELVKLGGLPEYRQNVLTDNGNVILDVHNLTILDAI
ALENKINNIAGVVTVGLFANRGADVALIGTADGVKTVELK
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgactcaggatgaacttaaaaaagcagtaggctgggcagcattagaatatgtcaaacct
ggcactatcgttggggtcggtactggctcaactgcggcacattttatcgatgctcttgct
tccattaaaggccagatcgaaggagctgtttctagctctgatgcctctaccgctaaactg
aaaagttatggcattcaggtatttgattgcaacgaagtcgatgagctggacatttatgtc
gatggtgctgatgaaattaacagccaaatgcagatgatcaaaggcggtggtgcggctttg
acccgcgagaaaatcattgcggccattgcgcgtaaattcatctgtattgccgatgcttcc
aagcaggttgatgtgctgggtaaattcccgttgccggtcgaagttatcccaatggcgcgt
tcttatgtggcgcgtgaactggtgaaattaggcgggttacctgaatatcgccagaatgtt
ttgactgataacggcaatgttattttggatgtccataatctgactattttggatgccatt
gcgcttgaaaataaaattaataatattgccggtgttgtcactgtggggctatttgccaac
cgaggtgctgatgttgcactaattggcactgccgatggtgttaaaaccgtagaacttaag
tga

DBGET integrated database retrieval system