KEGG   Yersinia enterocolitica subsp. palearctica 105.5R(r): YE105_C1298Help
Entry
YE105_C1298       CDS       T01480                                 

Definition
(GenBank) succinyl-CoA synthetase subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
yep  Yersinia enterocolitica subsp. palearctica 105.5R(r)
Pathway
yep00020  Citrate cycle (TCA cycle)
yep00640  Propanoate metabolism
yep00660  C5-Branched dibasic acid metabolism
yep01100  Metabolic pathways
yep01110  Biosynthesis of secondary metabolites
yep01120  Microbial metabolism in diverse environments
yep01130  Biosynthesis of antibiotics
yep01200  Carbon metabolism
Module
yep_M00009  Citrate cycle (TCA cycle, Krebs cycle)
yep_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:yep00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    YE105_C1298
   00640 Propanoate metabolism
    YE105_C1298
   00660 C5-Branched dibasic acid metabolism
    YE105_C1298
Enzymes [BR:yep01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     YE105_C1298
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: ADZ41794
Position
1550115..1551281
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQAKQLFARYGMPAPTGYACTTPREAEEAASKIGAGPWVVKCQVHAGGRGKAGGV
KLVNSKEDIRAFAEQWLGKKLVTYQTDAHGQPVHQILVEAATDIDKELYLGAVIDRSSRR
VVFMASTEGGVEIEKVAEETPELIHKVALDPLTGPQPYQGRELAFKLGLTGKQVAQFTKI
FMGLATLFLERDLAMVEINPLVITKQGDLVCLDGKLGADGNALFRQPELREMRDKSQEDE
REAQAAQWELNYVALDGNIGCMVNGAGLAMGTMDIVKLHGGEPANFLDVGGGATKERVTE
AFKIILSDDKVKAVFVNIFGGIVRCDLIADGIIGAVEEVGVNVPVVVRLEGNNAELGAKK
LADSGLNIIAATSLTDAAQQVVAAVGAK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatttacacgaatatcaggcaaaacaactgtttgctcggtatggtatgccagcgcca
actggctacgcttgtaccacaccgcgtgaagcagaagaagccgcatctaaaatcggtgct
ggcccgtgggtggttaaatgtcaggtacatgctggtggtcgcggtaaagcgggcggcgtg
aaactggttaacagcaaagaagatattcgtgctttcgctgaacagtggttgggtaaaaag
ctggtcacttaccagacagatgcgcatggtcaaccggttcaccaaattttggttgaagca
gcgactgatatcgacaaagagctatatctgggtgcggttattgaccgtagctcccgtcgt
gtggtgtttatggcatccactgaaggcggcgttgaaattgaaaaagtggccgaagaaaca
ccagaactgatccataaggtcgcattggatccattgactggcccgcagccttatcaaggt
cgcgaattggcattcaaactgggtttaactgggaagcaagtggctcagttcaccaagatc
tttatgggtctggcgactctgttcctggaacgtgacttggcgatggttgagataaacccg
ctggttatcaccaaacagggtgatctggtttgtttggatggcaaactgggtgccgatggt
aacgctttgttccgtcaaccagaattacgtgaaatgcgtgataaatctcaggaagatgag
cgcgaagcacaggctgcacagtgggaactgaactatgtcgccttggatggcaacattggt
tgcatggtaaacggtgccggcttggcaatgggtactatggatattgtgaaactgcacggt
ggtgaaccagctaacttccttgatgtggggggcggtgccactaaagagcgcgtgactgaa
gcgttcaaaatcattttgtctgatgacaaagtgaaagcagttttcgttaatatcttcggc
ggtattgtgcgctgtgacctgattgctgacggcattattggtgcagttgaagaagtgggt
gtcaacgtgccagttgtagtgcgtttggaagggaataacgccgagctgggtgccaagaaa
ctggcagacagcggtttgaatatcattgctgcgaccagcctgacagatgcggctcagcaa
gttgtagcggcagtgggggctaaataa

DBGET integrated database retrieval system