KEGG   Yersinia enterocolitica subsp. palearctica 105.5R(r) (serotype O 9): YE105_C1589Help
Entry
YE105_C1589       CDS       T01480                                 

Definition
(GenBank) hypothetical protein
  KO
K11895  type VI secretion system protein ImpH
Organism
yep  Yersinia enterocolitica subsp. palearctica 105.5R(r) (serotype:O:9)
Brite
KEGG Orthology (KO) [BR:yep00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:yep02044]
    YE105_C1589
Secretion system [BR:yep02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YE105_C1589
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_TssG
Motif
Other DBs
NCBI-ProteinID: ADZ42085
Position
complement(1860298..1861323)
Genome map
AA seq 341 aa AA seqDB search
MQPDDNIQQQNQLNLDTWYQQAEPWNAGFISMMRANAARTPDMPAPAKAMLPKQETFRIG
QSANMAFSPREIAHVEMKDGKMDLQLFGLGIWGPHGAMPLQMTELAYTRAELHDHTLTDF
ADLFHHRALSQLYRAWFVSQDTASLDRQHDEKFSFYIGSLVGLDPAELTHSALPVHAHLA
SSAHLIREARNPEGLVGALQYYFEVPVSMVEYAQQWIFLDKSDQTQLGDGASAMLLGDGA
ILGDTVLDRQHKFELILGPLSLQQYLRFSPSGQDLPVLREWVRNFVGFEYAWEVQLLLTA
AEVPTATLEGTSQLGYTSWLAREDVSANVRGMSFEPEMHLY
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgcaacccgatgacaacatacagcaacagaaccaactcaatctggatacctggtatcag
caagcagagccatggaatgccggttttatcagcatgatgcgggctaatgcggcccgaact
cccgatatgcccgctcccgctaaagctatgctgccgaaacaggaaacctttcgtatcggg
caaagtgccaatatggcgttctcaccacgtgagatagcccatgttgaaatgaaagacggg
aagatggacctacagctttttggtctgggtatctgggggccgcacggcgcgatgccgttg
caaatgactgaactggcctacactcgcgctgagttgcatgaccatacactgaccgacttt
gccgatctatttcatcatcgggcgctatcacagctctatcgcgcatggtttgtctctcag
gacaccgcttcgcttgacaggcaacatgatgagaaattctctttttatatcggcagcctg
gtcggtttagacccagcggagctgacacatagtgcgctgccggtgcatgctcatctggct
tcatccgcccatcttattcgtgaagcacgtaaccccgaaggcttagtcggcgcattgcaa
tactactttgaagtgccggtcagcatggtcgaatacgcccaacagtggatctttctggat
aaaagtgaccagacgcaattgggcgatggtgcctcggcgatgctgttaggtgacggtgcc
attctgggcgacaccgttttagaccgacagcataagtttgagctgatacttggcccgctc
agcctgcaacagtatttgcgtttcagcccatcaggacaggatttaccggtattacgtgaa
tgggttcgtaactttgtcggatttgaatatgcctgggaagtgcagttgttgttaaccgcc
gctgaggttcctaccgccacattggagggcaccagccagttggggtacaccagttggtta
gcccgagaggatgtctcagccaacgtacgcggaatgagttttgaacccgaaatgcacctt
tattaa

DBGET integrated database retrieval system