KEGG   Yersinia enterocolitica subsp. palearctica 105.5R(r) (serotype O 9): YE105_C1598
Entry
YE105_C1598       CDS       T01480                                 

Definition
(GenBank) hypothetical protein
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
yep  Yersinia enterocolitica subsp. palearctica 105.5R(r) (serotype:O:9)
Pathway
yep03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:yep00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    YE105_C1598
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:yep02044]
    YE105_C1598
Secretion system [BR:yep02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   YE105_C1598
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-ProteinID: ADZ42094
Position
1874075..1874560
AA seq 161 aa
MSQDMFIKIDGIEGESLDANHKNEIQVLAWKWDVSQHSNMHSGSGGGSGKATVSDFCFTH
YIDKASPNLLSYCLLGKHIKNIQFVLRKAGGDPLEYLTIKFTDVIITRVDMAGSLEDETR
PREEIRFSFTKMTQDYVMQNAEGHKSGVISANYDVKANQQS
NT seq 486 nt   +upstreamnt  +downstreamnt
atgtcgcaagatatgtttattaaaattgatggtatcgaaggcgaatctttagatgctaac
cacaaaaacgaaattcaggtgctggcttggaaatgggacgtttctcagcactcaaatatg
cacagtggctcaggcggtggttcaggtaaagcaactgtttctgacttctgtttcacgcat
tatatcgataaagcaagcccgaacttattgagctattgcttgttgggtaagcatattaag
aatatccaattcgttctgcgtaaagcaggtggcgatccactggaatacctgactattaaa
tttaccgatgtaatcatcactcgtgttgatatggccggttctcttgaagatgaaactcgt
ccacgtgaagaaattcgtttctcattcaccaagatgactcaagactacgttatgcagaat
gctgaaggccataaatctggcgttatttctgctaactacgatgttaaagctaaccagcaa
agctaa

DBGET integrated database retrieval system