KEGG   Yersinia enterocolitica subsp. palearctica 105.5R(r): YE105_C2028Help
Entry
YE105_C2028       CDS       T01480                                 

Definition
(GenBank) pyruvate kinase
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Organism
yep  Yersinia enterocolitica subsp. palearctica 105.5R(r)
Pathway
yep00010  Glycolysis / Gluconeogenesis
yep00230  Purine metabolism
yep00620  Pyruvate metabolism
yep01100  Metabolic pathways
yep01110  Biosynthesis of secondary metabolites
yep01120  Microbial metabolism in diverse environments
yep01130  Biosynthesis of antibiotics
yep01200  Carbon metabolism
yep01230  Biosynthesis of amino acids
Module
yep_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
yep_M00002  Glycolysis, core module involving three-carbon compounds
yep_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
yep_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:yep00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YE105_C2028
   00620 Pyruvate metabolism
    YE105_C2028
  09104 Nucleotide metabolism
   00230 Purine metabolism
    YE105_C2028
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:yep04131]
    YE105_C2028
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:yep04147]
    YE105_C2028
Enzymes [BR:yep01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     YE105_C2028
Membrane trafficking [BR:yep04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    YE105_C2028
Exosome [BR:yep04147]
 Exosomal proteins
  Proteins found in most exosomes
   YE105_C2028
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PK PK_C HpcH_HpaI IMPDH
Motif
Other DBs
NCBI-ProteinID: ADZ42524
Position
complement(2338635..2340047)
Genome map
AA seq 470 aa AA seqDB search
MKKTKIVCTIGPKTESEEMLTNLLKAGMNVMRLNFSHGDYEEHGQRIKNIRAVMAKTGLK
AGILLDTKGPEIRTMKLEGGKDAALVAGQTFTFTTDQSVIGNNNIVAVTYPGFAADLKIG
NTVLVDDGLIGMEVTEVTESTVVCKVLNNGDLGENKGVNLPGVSIQLPALAEKDKADLIF
GCEQGVDFVAASFIRKRSDVLEIREHLKAHGGEHIQIISKIENQEGLNNFDEILEASDGI
MVARGDLGVEIPVEEVIFAQKMMIEKCNRARKVVITATQMLDSMIKNPRPTRAEAGDVAN
AILDGTDAVMLSGESAKGKYPLESVTIMATICERTDRIMPSRIETLNDNRKMRITEAVCR
GAVETAEKLEAKVIVVATGGGKSAKSVRKYFPTATILALTTNEVTARQLILTKGVITQLV
NEIASTDDFYRIGKEAALASGLAQKGDVVVMVSGALVPSGTTNTSSVHVL
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagactaaaattgtttgtactatcggtccaaaaaccgaatctgaagaaatgctg
acgaacctgctgaaagctggcatgaacgttatgcgcttaaatttttcccacggtgactat
gaagaacatggtcaacgtatcaagaatatccgtgctgtcatggcaaaaactggcttgaaa
gccggtatcttgttggacaccaagggcccagaaattcgcaccatgaaactggaaggcggc
aaagatgcggctctggttgcaggtcagactttcactttcaccactgatcaaagcgttatt
ggtaacaacaacatcgttgctgttacctaccctggctttgctgctgatctgaaaattggc
aacactgtgctggttgacgatggtttgatcggcatggaagtcaccgaagttactgaaagc
actgtggtatgtaaagtgctgaacaatggtgatttaggtgaaaacaaaggcgttaacttg
ccaggtgtttctatccaactgccagcactggctgaaaaagataaagctgacctgatcttt
ggttgtgagcaaggcgtggacttcgttgcggcatcctttatccgtaaacgttcagacgtg
ctggaaatccgcgaacacttgaaagcccacggtggtgagcacattcagatcatctccaaa
attgaaaaccaggaaggtctgaataacttcgacgaaatcctggaagcctccgacggtatc
atggttgctcgtggtgacctgggtgttgagatcccggttgaagaagttatcttcgcgcag
aagatgatgattgagaaatgtaaccgcgcacgtaaagttgttattactgcaactcagatg
ctcgattccatgatcaaaaacccacgccctacccgtgcagaagcaggcgacgttgctaac
gccattctggacggtacagatgccgtgatgctgtctggtgaaagtgctaagggtaagtac
ccattagagtctgttaccatcatggcgaccatctgtgagcgtacagaccgtatcatgcct
agtcgcatcgaaacgctgaacgacaatcgcaaaatgcgtatcactgaagccgtttgccgt
ggtgcagtagaaaccgcagaaaaactggaagcaaaagtgatcgtggtagcaactggcggg
ggtaaatctgccaagtcagtacgtaaatacttcccaacagcaaccattttggcactgacc
accaatgaagtgaccgctcgtcagttaatcctgaccaaaggcgtgataactcaactggtc
aacgagattgcttcaacagatgacttctaccgcatcggtaaagaagcagctctggctagc
ggtctggcacaaaaaggcgacgttgtcgtgatggtttctggtgcgttagtgccaagtggc
accactaatacctcttccgtgcacgttttataa

DBGET integrated database retrieval system