KEGG   Yersinia enterocolitica subsp. palearctica 105.5R(r): YE105_C2030Help
Entry
YE105_C2030       CDS       T01480                                 

Definition
(GenBank) riboflavin synthase subunit alpha
  KO
K00793  riboflavin synthase [EC:2.5.1.9]
Organism
yep  Yersinia enterocolitica subsp. palearctica 105.5R(r)
Pathway
yep00740  Riboflavin metabolism
yep01100  Metabolic pathways
yep01110  Biosynthesis of secondary metabolites
Module
yep_M00125  Riboflavin biosynthesis, GTP => riboflavin/FMN/FAD
Brite
KEGG Orthology (KO) [BR:yep00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    YE105_C2030
Enzymes [BR:yep01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.9  riboflavin synthase
     YE105_C2030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lum_binding Calycin_like
Motif
Other DBs
NCBI-ProteinID: ADZ42526
Position
2342738..2343391
Genome map
AA seq 217 aa AA seqDB search
MFTGIVQGSAPVVAIDEKSNFRTHVVEMPTEMLPELALGASVAHNGCCLTVTEVNGNRVS
FDLMKETLRITNLGDIKVGDVVNLERAAKFSDEIGGHLMSGHIICTAEIAKIYTSENNRQ
IWFRLPSDDLMKYVLHKGFIGIDGISLTIGEVVGNRFCVHLIPETLARTTLGKKRLGHRV
NIEIDPQTQAVVDTVERVLAQREIAQVAVAAEKVARA
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgtttaccggtattgttcaaggctccgcgccagtggttgccattgacgagaaatccaac
ttccgcacccatgtggtcgaaatgccaactgagatgttacctgaattagcattaggtgct
tcagtggcccacaatggctgctgtttgacagtgactgaagttaatggaaatcgagtcagt
tttgatttaatgaaggaaactctgcgtattaccaatttgggtgatattaaagtaggcgat
gtggttaatctggagcgggccgctaaatttagtgatgaaattggcgggcatcttatgtcc
ggtcatattatttgtaccgctgaaatagccaaaatatatacctcagaaaataaccgtcag
atctggtttcgactgcccagcgacgatttaatgaaatatgtattacacaaaggctttatc
ggtattgatggcatcagtctgaccattggcgaggtggtgggtaaccgtttttgcgttcat
ttgattccggaaacactggcgcgaaccacattaggtaaaaagcgactagggcatcgggtg
aatattgaaatagacccacaaacacaggctgtagtggataccgttgagcgagtattggca
caacgcgaaattgctcaggtagcagtagcggctgaaaaagtcgctcgcgcatag

DBGET integrated database retrieval system