KEGG   Yersinia enterocolitica subsp. palearctica 105.5R(r): YE105_C2034Help
Entry
YE105_C2034       CDS       T01480                                 

Definition
(GenBank) DNA-binding transcriptional repressor PurR
  KO
K03604  LacI family transcriptional regulator, purine nucleotide synthesis repressor
Organism
yep  Yersinia enterocolitica subsp. palearctica 105.5R(r)
Brite
KEGG Orthology (KO) [BR:yep00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:yep03000]
    YE105_C2034
Transcription factors [BR:yep03000]
 Prokaryotic Type
  Helix-turn-helix
   LacI family
    YE105_C2034
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peripla_BP_3 Peripla_BP_1 Peripla_BP_4 LacI HTH_Tnp_ISL3 PucR HTH_23 HTH_3 HTH_10
Motif
Other DBs
NCBI-ProteinID: ADZ42530
Position
complement(2347393..2348418)
Genome map
AA seq 341 aa AA seqDB search
MATIKDVAKHAGVSTTTVSHVINKTRFVAENTKAAVWAAIKELHYSPSAVARSLKVNHTK
SIGLLATSSEAPYFAEVIEAVENSCYSKGYTLILCNSHNNLDKQKAYLAMLAQKRVDGLL
VMCSEYPEQLLGMLEDYRNIPMVVMDWGTARGDFTDSIIDNAFEGGYLAGRYLIERGHRD
IGAIPGQLSRNTGGGRHQGFLKALEEANITLREEWVVQGDFEPESGYKAMHQILTQKHRP
TAVFCGGDIMAMGAICAADELGLRVPQDISVIGYDNVRNARYFSPALTTIHQPKERLGET
AFAMLLDRIVSKREDPQTIEVHPKLVERRSVADGPFRDYRR
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atggcaacgattaaagatgtggccaaacacgcgggtgtgtctactaccaccgtttcgcac
gttatcaacaaaactcgtttcgtcgccgaaaacaccaaggccgctgtgtgggcagccatt
aaagaactgcattattcaccgagtgctgtggcgcgcagtttgaaagttaatcacactaaa
tcaattggcttgttggcgacatccagcgaagccccctattttgctgaagtgatcgaagcg
gttgaaaatagctgttatagcaaaggctacactctgattttatgtaactctcataataat
ctggacaagcaaaaagcctatttggcgatgctggcacaaaaacgtgttgatggcttattg
gtgatgtgttctgaatatccagaacagttactgggaatgttagaggattatcgcaatatt
ccgatggtagtgatggattggggtaccgcccgtggcgattttaccgattcgattattgat
aatgcattcgaaggcggttatttagctggccgttatcttattgagcgtggtcaccgcgat
atcggggcgatccccggccagttatcgcgtaataccggtggcggtcgccatcagggcttc
ctgaaagcattagaggaggccaacatcacgctgcgagaagaatgggtcgttcaaggtgat
tttgaaccagaatccggctataaagccatgcaccaaattctgacacaaaagcatcgtccg
actgctgtattctgtggtggcgatattatggcaatgggcgcgatatgcgccgcagatgaa
ttaggcttgcgtgtaccacaagatatttcggtgatcgggtatgacaatgtgcgtaatgct
cgctatttctcgccagcgttgaccaccattcatcagccaaaagaacgattgggtgaaacg
gcttttgctatgttgctcgacagaattgtcagcaaacgcgaagaccctcaaaccattgaa
gtacatcccaaactggtcgaacgtcgttctgttgctgatggcccattccgcgattatcgt
cgctaa

DBGET integrated database retrieval system