KEGG   Yersinia enterocolitica subsp. palearctica 105.5R(r): YE105_C2041Help
Entry
YE105_C2041       CDS       T01480                                 

Definition
(GenBank) TetR family transcriptional regulator
  KO
K16137  TetR/AcrR family transcriptional regulator, transcriptional repressor for nem operon
Organism
yep  Yersinia enterocolitica subsp. palearctica 105.5R(r)
Brite
KEGG Orthology (KO) [BR:yep00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:yep03000]
    YE105_C2041
Transcription factors [BR:yep03000]
 Prokaryotic Type
  Helix-turn-helix
   TetR/AcrR family
    YE105_C2041
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TetR_C_13 TetR_N TetR_C_6 DUF99
Motif
Other DBs
NCBI-ProteinID: ADZ42537
Position
complement(2354046..2354654)
Genome map
AA seq 202 aa AA seqDB search
MNKTQHAHVDTREHLLATGESLSLRLGFNGMGLSQLLTTAGIPKGSFYHYFRSKEVFGEA
MLQRYFDRYDARMATLLTGSQGDKRHHLLHYFAQAIANYCGSECHNACLAVKLSAEVSDL
SEPMRHALDIGTARVIGRLQDAIEAGIEEGSLRITLSPAATAETLYALWLGASLRAKVKR
SVAPLTCALESIELILQPAQLS
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaaacacagcacgcacatgtagacacccgtgaacatctgttagcaaccggtgag
agcctcagcctgcgcctcggttttaatggcatgggcctcagccagttactcacgactgcg
ggtatacctaagggttcgttttatcactatttccgctcgaaggaagtatttggtgaggcg
atgctacagcgctattttgatcgctatgatgcacggatggcaaccctgttaaccggttcg
caaggtgataagcgccaccatctgctgcactattttgctcaagcgattgctaactattgt
ggcagtgaatgccacaatgcttgtctggcggttaaactatcagctgaagtgagtgattta
tccgaacctatgcgtcatgcgttagatatcggcactgctcgcgtcattggtcgtttgcaa
gatgccatcgaagccggcattgaagaaggctctttgcgtattacgctttcccctgcggca
accgcagaaacgctctatgccttgtggctgggcgcttcgttgcgagcgaaggtgaaacga
tcagttgcgccgctgacctgtgcgctagaaagtatcgaactgattttacaacccgctcaa
ttatcctga

DBGET integrated database retrieval system