KEGG   Yersinia enterocolitica subsp. palearctica 105.5R(r): YE105_C2049Help
Entry
YE105_C2049       CDS       T01480                                 

Definition
(GenBank) outer membrane lipoprotein
  KO
K06077  outer membrane lipoprotein SlyB
Organism
yep  Yersinia enterocolitica subsp. palearctica 105.5R(r)
Brite
KEGG Orthology (KO) [BR:yep00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99992 Structural proteins
    YE105_C2049
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rick_17kDa_Anti Bacteriocin_IIc Gly-zipper_Omp Gly-zipper_YMGG DUF533 POR_N
Motif
Other DBs
NCBI-ProteinID: ADZ42545
Position
complement(2361855..2362322)
Genome map
AA seq 155 aa AA seqDB search
MIKPLIAVAIAAVTLTGCANNNTLSGDVFSASQAKQVQTVTYGTLLSVRPVTIQGGDDNN
VMGAIGGAVLGGFLGNTVGGGTGRSLATAAGAVAGGMAGQGVQGAMNRTDGVQLEVRKDD
GTTILVVQKQGPTRFSVGQRVMLASSGSTVTVSPR
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atgatcaagccattaatcgccgttgctattgctgcggttactctgaccggttgtgctaac
aacaacaccttatcgggtgacgtttttagcgcgtcacaagccaaacaagtacaaacggtg
acttacggtactctgctttccgtgcgtccggtgacgattcaaggcggcgatgacaacaat
gttatgggtgcaatcggtggtgctgtactgggtggtttcctcgggaatactgtcggtggc
ggcacaggccgtagcctggcgacagcagctggtgcggttgctggtggtatggcaggacaa
ggtgttcaaggtgcaatgaaccgtactgacggcgtacaacttgaagtgcgtaaagatgat
ggcaccactattctggttgttcagaaacaaggccccacccgctttagcgtaggccagcgc
gtgatgcttgccagcagcggcagtacagtgactgttagcccgcgctaa

DBGET integrated database retrieval system