KEGG   Yersinia enterocolitica subsp. palearctica 105.5R(r): YE105_C2065Help
Entry
YE105_C2065       CDS       T01480                                 

Definition
(GenBank) peptide transport system permease protein
  KO
K19227  cationic peptide transport system permease protein
Organism
yep  Yersinia enterocolitica subsp. palearctica 105.5R(r)
Pathway
yep01503  Cationic antimicrobial peptide (CAMP) resistance
yep02010  ABC transporters
Module
yep_M00739  Cationic peptide transport system
Brite
KEGG Orthology (KO) [BR:yep00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    YE105_C2065
 09160 Human Diseases
  09168 Drug resistance
   01503 Cationic antimicrobial peptide (CAMP) resistance
    YE105_C2065
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:yep02000]
    YE105_C2065
Transporters [BR:yep02000]
 ABC Transporters, Prokaryotic Type
  Peptide and nickel transporters
   Cationic peptide transporter [MD:M00739] [OT]
    YE105_C2065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: ADZ42561
Position
complement(2377261..2378226)
Genome map
AA seq 321 aa AA seqDB search
MIIFTLRRLLLLVITLFMLSLVSFSLSYFTPHAPLNGASLLDAYRFYFSSLLQWDFGVSS
INGQPISEQLREAFPATMELCVLAFTLALFVGIPLGIIAGVMRGKFADIAISSIALLGFS
IPVFWLALLLMLFFSLHLGWLPVSGRFDLLYQVKPVTGLALVDAWLSPSPYRKEMMLSAL
QHMILPITALAVAPTTEVIRLMRTSTDDVIGQNYIKAAATRGLSRFTIIRRHVLHNALPP
IIPKLGLQFSTMLTLAMITEVVFNWPGLGRWLINAIRQQDYAAISAGVMVVGSLVIVINV
LSDILGAMMTPLKHKEWYALR
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgataatcttcacgttacggcgcttattactgttggtaataaccctatttatgttgtca
ttggtcagttttagcctgagctattttactcctcatgcccccttgaatggcgcatctctg
ctcgatgcctaccgtttctatttcagcagcttgcttcagtgggactttggcgtttccagc
attaatgggcagcccatcagtgagcaattgcgcgaagcttttcctgccactatggagctg
tgtgttctggcctttaccctggcactgtttgtcggcattccactggggattattgccgga
gtgatgcgcggcaaatttgctgatattgccatcagttcaatagcgctactcggcttctca
atcccggtgttttggctggctctgctattgatgttgttcttttcactgcatttgggttgg
ctgccggtttcagggcggtttgacctgttatatcaagtgaaacccgtcaccgggctggcg
ttagtcgatgcctggctgtcaccctcgccgtatcgtaaagagatgatgctcagtgcgttg
caacatatgattttacccatcacggcactggccgtggcccccaccacagaagttatccgc
ctgatgcgtaccagcaccgatgatgttatcgggcaaaattacattaaagcggcggcaacc
cgtggtttgtcacgatttaccattattcgccgccatgtgttgcacaatgccttacccccc
atcattccaaaattggggttacagttctcgaccatgctgacattggcgatgataaccgaa
gtggtgtttaactggccggggttaggtcgttggctaatcaatgcgattcgacaacaagat
tacgccgcaatttcagccggtgtgatggtggttggttcgttggttatcgtcattaacgta
ctgtcggatattctgggcgcgatgatgacgccgttaaagcataaggaatggtatgccctt
cgataa

DBGET integrated database retrieval system