KEGG   Yersinia enterocolitica subsp. palearctica 105.5R(r): YE105_C2071Help
Entry
YE105_C2071       CDS       T01480                                 

Definition
(GenBank) phage shock protein B
  KO
K03970  phage shock protein B
Organism
yep  Yersinia enterocolitica subsp. palearctica 105.5R(r)
Brite
KEGG Orthology (KO) [BR:yep00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic Defense System [BR:yep02048]
    YE105_C2071
Prokaryotic defense system [BR:yep02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   PspC-PspB
    YE105_C2071
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PspB Rnk_N YPEB BatA Ac76 Peptidase_S49_N
Motif
Other DBs
NCBI-ProteinID: ADZ42567
Position
2383903..2384130
Genome map
AA seq 75 aa AA seqDB search
MSILFLAIPLTIFVLFVAPIWLWLHYSNRQQSGAQLSHQDMQRLSQLTDDARRMRERIQA
LEEILDAEHPNWRQS
NT seq 228 nt NT seq  +upstreamnt  +downstreamnt
atgagtatcctatttcttgccataccgttgaccatttttgtgttgtttgtcgcaccgatt
tggttatggctgcattacagcaatcgccagcaaagcggtgctcaacttagtcaccaggat
atgcaacgtctatcgcagttaactgacgatgcacgccggatgcgtgagcgcattcaggca
ttggaagaaattcttgatgctgagcatccaaattggaggcagtcataa

DBGET integrated database retrieval system