KEGG   Yersinia enterocolitica subsp. palearctica 105.5R(r): YE105_C2081Help
Entry
YE105_C2081       CDS       T01480                                 

Definition
(GenBank) murein peptide amidase A
  KO
K14054  protein MpaA
Organism
yep  Yersinia enterocolitica subsp. palearctica 105.5R(r)
Brite
KEGG Orthology (KO) [BR:yep00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99985 Amino acid metabolism
    YE105_C2081
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M14 AstE_AspA DUF2817
Motif
Other DBs
NCBI-ProteinID: ADZ42577
Position
complement(2391989..2392696)
Genome map
AA seq 235 aa AA seqDB search
MTPYRPRSTRGNLITLGQHYGTSRLGAPLLYFPAPAPSAQTGLIIAGTHGDESAAIVALS
CALRSISPEQQHHHVILAVNPDGCQLGLRANANGVDLNRNFPAKNWQAGETVYRWNSAAD
ARDVVLSTGECAASEPETQALCALITQLSPRWVVSFHEPLACIEDPDSSALGEQLAANFN
LPLVTNVGYATPGSFGSWCADISLPCITAELPPISADAASECYLAALIDLLTRPD
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgaccccatatcgcccccgctccacacgtggaaacctgataaccttagggcagcactac
ggcacatcccgtttaggtgcgccgctgctgtatttcccggcaccggccccgtcagcgcaa
accgggctgattatcgcggggactcatggcgatgaaagtgcggcaattgtagccctctcc
tgcgcgttgcgtagcatttcccctgaacaacagcaccaccatgtgatattggcagtcaat
cctgatggttgccaattggggctgcgggctaatgccaatggcgtagatcttaatcgtaat
tttccggccaaaaactggcaggctggcgaaacagtatatcgctggaacagtgcggcggat
gcaagagatgtggtgttatcgactggagagtgcgcagcctccgaacccgaaactcaagca
ttgtgtgcattgattacgcagttgtctccgcgctgggtagtctcttttcacgaaccatta
gcctgtattgaagaccctgatagttcagcattgggggaacagttggcggcaaactttaac
ttaccgctggtgacaaatgtgggttacgccactccggggtcattcggcagttggtgcgcc
gacatcagcttaccttgtattacggcggaattacccccaatctctgccgatgcagccagt
gaatgttatctggctgccctgatagacttactcaccagaccggattaa

DBGET integrated database retrieval system