KEGG   Yersinia enterocolitica subsp. palearctica 105.5R(r): YE105_C2082Help
Entry
YE105_C2082       CDS       T01480                                 

Definition
(GenBank) putative periplasmic murein peptide-binding protein
  KO
K15580  oligopeptide transport system substrate-binding protein
Organism
yep  Yersinia enterocolitica subsp. palearctica 105.5R(r)
Pathway
yep01501  beta-Lactam resistance
yep02010  ABC transporters
yep02024  Quorum sensing
Module
yep_M00439  Oligopeptide transport system
Brite
KEGG Orthology (KO) [BR:yep00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    YE105_C2082
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    YE105_C2082
 09160 Human Diseases
  09168 Drug resistance
   01501 beta-Lactam resistance
    YE105_C2082
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:yep02000]
    YE105_C2082
Transporters [BR:yep02000]
 ABC Transporters, Prokaryotic Type
  Peptide and nickel transporters
   Oligopeptide transporter [MD:M00439]
    YE105_C2082
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_5 ACR_tran
Motif
Other DBs
NCBI-ProteinID: ADZ42578
Position
2392982..2394598
Genome map
AA seq 538 aa AA seqDB search
MRYFRYALCAALVGAAFGAANAADVPAGTVLAEKQELVRHIKDEPASLDPMKAVGLIEAQ
VARDLFEGLVNQDSHGQIIPGVATNWKTSDNQTYIFTLRKDAKWSNGDPVTAQDFVYSWR
RLVDPKSLSPFAWFAELAGMENAQQIIAGKMPPETLGVSAVNDYTLKVKLSKPVPYFPSL
TANFSLFPVPSTVVEKYGSDWTKVGNLVGNGAFKLQDRVVNEKLVLVPNDYYWDHAHTVL
TKVTFIPINQEANATKRYQAGDIDITESFPKNLYQKLLKDIPDQVYTPDQLGTYYYAFNT
QRAPTNDVRVRKALSYAIDRKIIAEKVLGTGEKPAYHFTPDVTAGYHPVTNLLQQQDQDE
LNAQAKALLHAAGYGPDKPLKLSLLYNTSDNNQKLAIAIASMWKKTLGVDVQMINQEWKT
YIDSRNTGNFDVVRASWVGDYNEPSTFLSLLTSTHSGNIAKFTSADYDRLLSEAGKQTNP
EALSDDYNKAEQIIADQVPIAPIYQFTNGRLIKPWVKGYPITNPEDVAYSQMIYIIKH
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atgcgctatttccgttatgcattatgtgccgcattggtgggggcagcgttcggcgcggca
aatgctgctgatgtccctgctggcactgtattggctgaaaaacaagaacttgttcgtcat
attaaagatgagcctgcgtcccttgacccaatgaaagcggttgggttaatcgaagctcag
gttgcccgtgatctattcgaagggctggttaaccaggattcgcatggacagataattcca
ggtgttgcgacaaattggaaaacgtcagataaccaaacctatatatttacgttacgcaaa
gatgctaaatggtcgaatggtgacccagtgaccgcacaggattttgtatatagttggcgt
cgcttggttgaccctaaaagtttatctcctttcgcctggtttgccgagctggctggcatg
gagaatgcgcaacagattattgccggaaaaatgccaccagaaactcttggggtcagtgct
gttaatgattacactctcaaagtcaaactcagcaagccggtgccttatttccccagcctg
accgctaatttcagtttattcccggtaccatcaaccgtggttgaaaaatacggtagtgac
tggactaaagtcggtaatctggtggggaacggcgcatttaaattacaagatagagtggtg
aatgagaagttggtattggtgccaaacgactattattgggaccatgctcatacagtcctc
accaaagtgacttttattcctatcaatcaggaagctaatgccactaagcgctatcaggca
ggtgatattgatattacggaatccttccctaaaaatctctatcagaaactattaaaagat
attcctgatcaggtttatacccccgaccaattaggcacttattattacgcatttaatacc
cagcgagcaccaacaaatgatgttcgggtgcgtaaagcattatcttatgcaatagatcgt
aaaattatcgctgaaaaagtcttgggtaccggggaaaaacctgcctaccactttacccct
gatgtcacggctggctatcatccggtaaccaatttattacaacaacaagaccaagacgaa
ctgaatgcacaagccaaagcgctactgcatgcggcgggttatgggcctgataagccacta
aaattatcgctgttgtataacacatcggataataatcaaaagttagccatcgccattgct
tcaatgtggaaaaaaacattgggtgtggatgttcaaatgattaaccaagagtggaagacc
tatattgatagccgcaacaccggaaattttgatgtggtccgtgcttcatgggttggtgat
tacaatgagccttctacattcctgtcattactgacctcgacccatagcggtaatatcgct
aagtttacgagtgcagattatgaccgtttgctgagtgaagcgggtaaacaaactaatcct
gaagcactgagtgatgattataataaagctgaacaaattattgcagatcaggtgccaata
gcacctatatatcaatttactaacgggcgcttaattaaaccgtgggtgaaaggttacccg
attactaacccggaggatgtggcatatagccaaatgatttacatcattaagcactag

DBGET integrated database retrieval system