KEGG   Yersinia enterocolitica subsp. palearctica 105.5R(r): YE105_C2087Help
Entry
YE105_C2087       CDS       T01480                                 

Definition
(GenBank) quaternary ammonium compound-resistance protein
  KO
K03297  small multidrug resistance pump
Organism
yep  Yersinia enterocolitica subsp. palearctica 105.5R(r)
Brite
KEGG Orthology (KO) [BR:yep00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:yep02000]
    YE105_C2087
Transporters [BR:yep02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   YE105_C2087
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Multi_Drug_Res EamA TMEM234
Motif
Other DBs
NCBI-ProteinID: ADZ42583
Position
2402380..2402712
Genome map
AA seq 110 aa AA seqDB search
MSGFMYLMMAIVAEVVATTMLKASDGFTRLVPSIVVVIGYGIAFWGLSQVVKTMPLGIAY
AIWSGLGIVLVSVAATFMYQQKLDWAAIAGMTLIIAGVLVINLLSKTPMH
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atgagtggtttcatgtatttaatgatggcaattgttgccgaggtggtagctaccacaatg
ctaaaagcctctgatggctttacccgtctggtgccctctattgtagtggtgattggttat
ggcattgctttctgggggttatcacaggtggtgaaaaccatgccattgggtattgcttat
gctatttggtcaggattggggattgtattagtgtccgtcgctgccacttttatgtaccag
cagaaattagactgggcggccattgccggtatgacattgattatcgccggtgtgttggtg
attaacctgctgtcgaagacgccgatgcattag

DBGET integrated database retrieval system