KEGG   Yersinia enterocolitica subsp. palearctica 105.5R(r): YE105_C2108Help
Entry
YE105_C2108       CDS       T01480                                 

Definition
(GenBank) universal stress protein UspE
  KO
K14055  universal stress protein E
Organism
yep  Yersinia enterocolitica subsp. palearctica 105.5R(r)
Brite
KEGG Orthology (KO) [BR:yep00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    YE105_C2108
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Usp
Motif
Other DBs
NCBI-ProteinID: ADZ42604
Position
complement(2427790..2428746)
Genome map
AA seq 318 aa AA seqDB search
MAKYQNILVAIDPNQDDQPALRRAVYLVRRNGGTIKAFLAIYDLSYDMTTLLSPDERTAM
RKGVISQRSAWISEQCRFYLDEGIPIEIKVVWHNRPYEAIIQEVLKFKHDLLLKMAHQHD
RLESIIFTPTDWHLLRKCPCPVWMVKDQPWPENGTALVAVNLSSEDPLHDPLNLRLVNET
RELAENLNQTPVHLISAYPVTPINIAIELPDFDPSVYNDAIRGQHLVAMKALRQQFGIDE
KFTHVEKGLPEEVIPDLAEHLRAGVVVLGTLGRTGLSAAFIGNTTEHVIDHLKCDLLAIK
PDGFTCPVENNENQEDIE
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagtatcagaatattctggttgctattgaccccaatcaggatgatcagcctgca
ttaaggcgtgcagtttatcttgtacggcgtaatggcggcacaattaaagcatttttggct
atttacgacttgtcctatgacatgaccactctactgtcgcctgatgagcgcaccgcaatg
cgcaaaggggttatcagccaacgttcagcatggataagtgaacagtgtcgattttatctt
gatgaagggataccgattgaaatcaaagtggtatggcacaatcggccctacgaagccatt
attcaggaagtcctgaaatttaagcatgatttattgctcaaaatggcacatcagcacgac
cgcctcgaatcaattatcttcacccccactgactggcatttattgcgtaaatgtccatgt
ccggtgtggatggtcaaagaccaaccttggccggaaaatggtactgcactggttgccgtc
aatctctcaagtgaagacccactgcatgacccacttaatctgcgtttagttaacgaaacc
agagaactcgctgaaaatctcaaccaaacaccggtgcacttgattagcgcctatccggtt
accccgattaacattgccattgaattacctgattttgatccgagcgtctataacgatgct
attcgtggccaacatttggtcgcgatgaaagcattgcgccagcaatttggtattgatgag
aaattcactcatgtcgaaaaagggttgccggaagaagttattcctgatctggcggaacat
ttacgggctggggtggtggttctgggcactttgggccgtacggggctatctgctgccttt
atcggaaataccacggagcatgtgatcgatcatctgaaatgtgatttgttagcgattaaa
ccggatggttttacttgtcctgtggaaaataatgaaaatcaagaagatatcgagtag

DBGET integrated database retrieval system