KEGG   Yersinia enterocolitica subsp. palearctica 105.5R(r): YE105_C2113Help
Entry
YE105_C2113       CDS       T01480                                 

Definition
(GenBank) putative short chain dehydrogenease
  KO
K00059  3-oxoacyl-[acyl-carrier protein] reductase [EC:1.1.1.100]
Organism
yep  Yersinia enterocolitica subsp. palearctica 105.5R(r)
Pathway
yep00061  Fatty acid biosynthesis
yep00780  Biotin metabolism
yep01040  Biosynthesis of unsaturated fatty acids
yep01100  Metabolic pathways
yep01130  Biosynthesis of antibiotics
yep01212  Fatty acid metabolism
Module
yep_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:yep00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    YE105_C2113
   01040 Biosynthesis of unsaturated fatty acids
    YE105_C2113
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    YE105_C2113
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosyntheses
    YE105_C2113
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:yep01004]
    YE105_C2113
Enzymes [BR:yep01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.100  3-oxoacyl-[acyl-carrier-protein] reductase
     YE105_C2113
Lipid biosynthesis proteins [BR:yep01004]
 Fatty acid synthase
  Component type
   YE105_C2113
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase GDP_Man_Dehyd NmrA Sacchrp_dh_NADP F420_oxidored NAD_binding_10 YjeF_N Peripla_BP_6 HEM4 Polysacc_synt_2 THF_DHG_CYH_C RmlD_sub_bind Ldh_1_C 3Beta_HSD Ribosomal_S11
Motif
Other DBs
NCBI-ProteinID: ADZ42609
Position
2432821..2433561
Genome map
AA seq 246 aa AA seqDB search
MTNTIQQVAIVTGASRGIGAAIAERLAQEGYTVLINYSRADDEAEALVRKIQQAGGNVLS
AKGDISDPAAVAQLFTKAETAFGGVDVLVNNAGIMSLSMVADSDDEHFDRQIAINLKGSF
NGMREAAKRLRNGGRIVNFSTSVVGLKLEKYAVYAATKAAVETMTAILAKELRGRDITVN
AVAPGPTATDLFLNGKSAELIEKMAKMAPLERLGTPGDIAAAVAFLVGKDGGWINGQVLR
ANGGLI
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgacaaataccattcagcaggtcgcgattgttaccggtgcatcacggggtattggtgcg
gcaatagccgagcgtttggctcaggagggctacaccgtcttaatcaattactctcgggct
gatgatgaagccgaagccttagtgcgtaaaattcaacaggcgggcggcaatgtattgagt
gccaaaggcgatattagcgatcccgccgctgtggctcaattgtttaccaaagctgaaacc
gccttcggtggggttgatgtgttggtcaataatgccggtattatgtcactcagcatggtt
gccgacagcgacgatgaacattttgaccgccaaattgccattaacctgaaagggagcttc
aacggaatgcgagaagcggcgaaacgactcagaaatggcggccgaattgttaatttctca
accagtgttgtgggcttaaagttggaaaagtatgctgtttatgctgccaccaaggctgca
gttgaaacgatgacggcaatactggcaaaagagttgcgaggccgcgatattactgtcaat
gctgtggcaccagggccgaccgcgactgatcttttccttaacggaaaatccgctgaactg
attgaaaaaatggcgaaaatggcacccttagaaagattgggcacaccaggggacattgca
gcggctgtggcatttttggtcggaaaagacggcggctggatcaatgggcaagtgttgcgt
gctaacggtggactgatttaa

DBGET integrated database retrieval system