KEGG   Yersinia enterocolitica subsp. palearctica 105.5R(r): YE105_C2132Help
Entry
YE105_C2132       CDS       T01480                                 

Definition
(GenBank) Yfc protein
Organism
yep  Yersinia enterocolitica subsp. palearctica 105.5R(r)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_Crp_2 MarR_2
Motif
Other DBs
NCBI-ProteinID: ADZ42628
Position
complement(2459531..2459671)
Genome map
AA seq 46 aa AA seqDB search
MDAGIAQRQTASQYLKQLVETGVLEEVSAGRSKLYINTRLLRELND
NT seq 141 nt NT seq  +upstreamnt  +downstreamnt
gtggatgctggtatagcgcagcggcagacggcatcacagtacctgaagcaactggtggaa
accggagttcttgaagaagtcagtgccggacgcagtaaactctacattaacacccgactg
ctgagggagctaaatgactga

DBGET integrated database retrieval system