KEGG   Yersinia enterocolitica subsp. palearctica 105.5R(r): YE105_C2143Help
Entry
YE105_C2143       CDS       T01480                                 

Definition
(GenBank) Membrane-fusion protein
  KO
K01993  HlyD family secretion protein
Organism
yep  Yersinia enterocolitica subsp. palearctica 105.5R(r)
Brite
KEGG Orthology (KO) [BR:yep00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99992 Structural proteins
    YE105_C2143
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biotin_lipoyl_2 HlyD_3 HlyD_D23 OEP Biotin_lipoyl Hema_stalk MobC
Motif
Other DBs
NCBI-ProteinID: ADZ42639
Position
2468874..2469974
Genome map
AA seq 366 aa AA seqDB search
MIFLGLLLVGSSLIYFGSRNDAVSVAKSIKSGVLTADEINIAFENVGGKLISRKVQESQQ
VKKGDVLMVLDEVDTDIAIERLKAVIRSQEALIRQEESAIHIATNETTLTEVSSWRKIEE
IQATLSAARASENLARTDFNRIAKLHNTGSVSQSVLDNAKSSLTTTHAAVIQAERQLASA
MIGTTPAQVKNLSEKESAQGMTLQSIANSRESIKNRQNILDQLLAQLDQSHAELRQLEVN
RQRLTLTAPASGKVLKLLYQPGEMIPAGAPAVLLETDRKYVDIYVNENMVTIYQPGTTVT
AQVPALDSQVRGVVRFASAAPSFADLRMTRERGQADLTSYQVRIYTEDKPQLLSGMTLEV
DDAEHR
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
gtgatctttttggggctactgcttgtggggtcaagtctcatctattttggctcaagaaat
gatgccgtctcggtggcgaaaagcatcaaatcaggggtgttaacggctgatgaaatcaat
attgcatttgaaaatgtgggcggaaaactaatcagtcgcaaggttcaggaatcccagcag
gtgaaaaaaggggacgtcctgatggtgctggatgaggtcgatactgacattgccattgaa
cgtcttaaggcggttattcgttctcaggaggcattgatccgtcaggaggaatcggctatc
catatcgccaccaatgaaaccacattaaccgaggtttcatcctggcgtaaaattgaagaa
attcaggctacattgagcgctgcccgtgccagtgaaaatctggcgcgcacggatttcaat
cgcattgctaagttgcataataccggtagtgtttcgcaatcggtgctggataatgccaaa
agcagtttgaccacaacccatgctgcagtgatacaagcagagcgtcaattggcttcagcg
atgattggcactacaccagcacaagtgaaaaatctgtcagaaaaagagagtgcgcagggc
atgacgctacagtcaattgctaactcacgcgaatctatcaaaaaccgccagaacattctg
gatcagttactggctcaattagatcaatctcatgcagaactcaggcaacttgaagtcaat
cgtcaacgattgacactgacggcacctgctagcggtaaagtcttaaaactcctttatcaa
cccggtgaaatgatcccggcaggcgcaccggctgtgctgttagaaaccgatcgcaaatac
gttgatatctacgttaatgaaaatatggtcaccatctatcaacctggaaccaccgtcacc
gcacaggttccggcgcttgatagtcaggttcgtggcgtggtgcgatttgccagcgcagca
ccatccttcgctgatctgcgcatgacacgggaacgaggccaggcggatctaacttcctat
caagtgcgtatctataccgaagataaaccacagttactgagcgggatgacacttgaggta
gatgatgcagaacatcgttaa

DBGET integrated database retrieval system