KEGG   Yersinia enterocolitica subsp. palearctica 105.5R(r): YE105_C2145Help
Entry
YE105_C2145       CDS       T01480                                 

Definition
(GenBank) putative glutathione S-transferase YghU
  KO
K11209  GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
yep  Yersinia enterocolitica subsp. palearctica 105.5R(r)
Brite
KEGG Orthology (KO) [BR:yep00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    YE105_C2145
Enzymes [BR:yep01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     YE105_C2145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C_2 GST_N GST_C GST_N_2 GST_N_3 GST_C_3 Cuticle_2
Motif
Other DBs
NCBI-ProteinID: ADZ42641
Position
complement(2471168..2472019)
Genome map
AA seq 283 aa AA seqDB search
MKDNEYQPPKVWTENNASGGVWSKINRPTAGARYEADLPVGKHPLQLYSMGTPNGQKVTI
LLEELLALGEKGAEYDAHLIRIGEGDQFSSGFVAVNPNSKIPALMDHSTTPPVRVFESGA
ILLYLADKFGHFLPKSPAARTEALNWLFWLQGAAPYLGGGFGHFYHYAPVKIEYAIDRFT
MEAKRQLDLLNTQLATHEYIAGDEYSIADIAIWPWYGNLVLGLQYEAGEFLDVKSYTHLI
RWTETIGKRPAVQRGRIVNKTWGTPEEQLAERHDASDFDRLIK
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgaaagataacgaatatcaaccacccaaagtctggacggaaaataatgccagcggtgga
gtgtggtccaaaatcaatcgcccgactgcgggtgccagatacgaagctgacctgccggtt
ggtaaacaccccttacagctgtattccatgggcacgccgaatggtcagaaggtcaccatt
ttgttggaggagttgttggctttgggcgaaaaaggtgcggaatatgatgcccatctgatt
cgtattggtgaaggtgatcagttctcaagtgggtttgttgccgttaatccaaattcaaaa
atcccggccttgatggaccattcaaccaccccgccagtccgggtttttgagtctggcgct
attctgctgtatttggcggataaattcggtcatttcttgccaaaatcccctgctgccaga
accgaagcactcaattggctgttctggctacaaggtgcggccccttatttgggcggtggt
ttcggccatttttatcactatgcaccagtgaaaattgaatacgccatcgaccgtttcact
atggaagccaagcgccagctcgatttgctcaatacacagctcgcgactcatgaatatatt
gcgggagatgagtattctattgcggatatcgctatctggccgtggtacggcaatctggta
ctgggcttgcaatatgaagcgggtgaattcttggatgtgaaatcctatactcacctgata
cgttggaccgaaaccattggtaagcgccctgctgtccagcgcggccgtatcgtcaataaa
acttggggaacgccagaagaacagttagctgagcgccatgatgcttcagattttgaccga
ctgataaaatag

DBGET integrated database retrieval system