KEGG   Yersinia enterocolitica subsp. palearctica 105.5R(r): YE105_C2438Help
Entry
YE105_C2438       CDS       T01480                                 

Definition
(GenBank) Sucrose-6-phosphate hydrolase
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
yep  Yersinia enterocolitica subsp. palearctica 105.5R(r)
Pathway
yep00052  Galactose metabolism
yep00500  Starch and sucrose metabolism
yep01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:yep00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    YE105_C2438
   00500 Starch and sucrose metabolism
    YE105_C2438
Enzymes [BR:yep01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     YE105_C2438
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C DUF4975
Motif
Other DBs
NCBI-ProteinID: ADZ42934
Position
complement(2795689..2797158)
Genome map
AA seq 489 aa AA seqDB search
MNPLIERANDALQTLASQVGQNFYPHYHLAPLAGWMNDPNGLIFFNGQYHAFYQHHPYDE
NWGPMHWGHATSHDMLSWQHQCIALAPGDLWDKDGCFSGCAVDDNGVLSLIYTGHVWLKG
EGDDSAIREVQCLATSQDGIHFDKQGVVLNPPVGIMHFRDPKVWFEDDCWWMVVGARDER
DHGQVLLYRGNSLQQWQFMQVLACADDSMGYMWECPDFFPLGNERILMFSPQGLAAKGYL
NRNLFQSGVLRGKWQPGADFKPSQPFTELDLGHDFYAPQSLLTADGRRVIIGWMDMWQSP
MPTKADNWSGCLTLPRELSIDCDGNLLIKAVREVEALRQTGEFITSMTLAQEKQLLHENC
QSLELQLTWDTTASHAERYGVQLADAQGTGGKVSVYVDNQANRLVLDRYYPQYGLTGYRS
VALPEQGLLSLRIFIDGSSLEVFINDGQACMSSRIYPTEHERCLSLYAENGQAELLHGEY
WQLVAKSSR
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgaatccattaattgaacgggccaatgatgcactgcaaactttagcttctcaggttggc
caaaatttctatccacattatcatttggctccgctggcagggtggatgaatgaccccaac
gggttgatcttttttaacggacagtatcacgcgttttatcagcatcacccttatgatgaa
aattgggggccgatgcattggggccatgcgaccagccacgacatgttgagttggcaacat
caatgcattgccttagcaccgggtgatttatgggataaagacggctgtttttctggttgt
gcggtagacgataatggcgtgttaagcctgatttataccggacatgtttggcttaaaggt
gagggtgatgacagcgctattcgcgaggtgcagtgcctggcaaccagtcaggatggcata
cattttgacaaacaaggtgtggtactgaacccgcccgtgggaatcatgcatttccgcgat
ccgaaagtgtggtttgaagatgattgttggtggatggtggtcggtgctcgagatgagcga
gatcatgggcaagtcttactatatcgcggcaattcattgcagcaatggcaatttatgcaa
gttttagcgtgtgcagacgacagcatgggatatatgtgggaatgtccagatttcttccca
ttagggaatgaacgcattctgatgttttcaccgcaggggctggcagcaaaaggttacctc
aatcgcaatttgttccaaagtggtgtcttacgtggcaaatggcagccaggagccgatttt
aagccatcgcagccttttaccgaactggatctgggccatgatttctatgcgcctcaatcc
ctacttacggctgatgggcggcgagtcattattggttggatggatatgtggcaatcgcct
atgccgaccaaggccgataattggagtggctgcttaaccttgccacgagaattaagtatt
gattgtgatggtaatttattaataaaagcggtacgggaggttgaagcactaaggcaaacc
ggtgaattcatcacatcaatgacactggcccaagagaaacaacttttacatgaaaattgc
cagagtctggaactgcaattgacgtgggataccacagccagtcatgcagaaagatatggg
gtgcagttagctgatgcccaaggaactggtggtaaagtttcggtttatgtcgataatcag
gctaatcgactagttttggataggtattacccacaatatggactgacggggtatcgcagt
gtggcattaccagaacaggggttattatcattacgtatatttattgatggttcgtcgttg
gaggtatttatcaatgacgggcaagcttgtatgagcagtcgtatctacccaaccgagcat
gaacgctgtttatctctgtatgcggagaatggtcaggccgagctactacacggcgaatac
tggcagttagtagctaaatcatcacgttga

DBGET integrated database retrieval system