KEGG   Yersinia enterocolitica subsp. palearctica 105.5R(r) (serotype O 9): YE105_C2617Help
Entry
YE105_C2617       CDS       T01480                                 

Definition
(GenBank) L-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
yep  Yersinia enterocolitica subsp. palearctica 105.5R(r) (serotype:O:9)
Pathway
yep00260  Glycine, serine and threonine metabolism
yep01100  Metabolic pathways
yep01110  Biosynthesis of secondary metabolites
yep01120  Microbial metabolism in diverse environments
yep01130  Biosynthesis of antibiotics
yep01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:yep00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    YE105_C2617
Enzymes [BR:yep01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     YE105_C2617
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 Cys_Met_Meta_PP DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: ADZ43113
Position
3023159..3024178
Genome map
AA seq 339 aa AA seqDB search
MLIDLRSDTVTQPDAAMRSAMTNAEVGDDVYGDDPTVNALEAQAAKLSGKEAALFLPTGT
QANLVALLTHCQRGEEYIVGQKAHNYLYEAGGAAVLGSIQPQPIDANDDGTLPLDKVLAA
IKPDDIHFAQTRLLSLENTHSGKVLPLSYLQQAWALTREQKLALHIDGARVFNAAVALNV
PLSEITQYCDTLTICLSKGLGAPVGSLLCGSAEYIKRARRWRKMTGGGMRQAGILAAAGL
YALEHNVARLKDDHDNALWLEQQLRALGVEIVAPGAQTNVLYIKQPAELATKLGSWMREH
GVLISAGPITRMITHINISRTDLEKVVALWREFLSEQRS
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgctgattgatttacgcagtgacacagtcacacaacctgacgccgccatgcgcagtgcc
atgaccaatgccgaagtcggcgatgatgtgtatggcgatgacccgacggtgaatgcttta
gaagcccaagccgccaaattatcgggcaaagaagccgcattattcctgccgaccggcaca
caagcaaacttggtggccctgttgactcactgtcagcgtggtgaagagtatattgtcggc
caaaaagcacataattatttgtatgaagccggtggtgccgcagtgcttggcagtatccag
ccacaacctattgatgccaatgatgacggcactttaccactggataaagtcttggccgct
atcaaacccgatgatattcattttgcccaaacccgactgttgagtttggaaaatacccac
agcggaaaagtattgccactgagctacttacagcaggcatgggcattgactcgtgaacag
aaacttgcgctacatattgatggtgctcgtgtttttaatgccgccgtggcattgaatgtc
cctctgagcgaaatcacccaatattgcgataccctgacaatctgcctctccaaagggttg
ggcgcgcctgttggctcattactgtgtggcagcgctgaatacattaaacgcgcgcgtcgt
tggcgcaaaatgaccggtggcgggatgcgtcaggccggaattctggcagcagcagggctg
tatgcattagagcataatgtggcgcgactaaaagatgaccatgacaatgccctctggctg
gagcaacaactgcgtgcgcttggggtagagatagtggctccgggagcgcaaaccaatgtg
ctgtatattaaacaacccgctgaattagccaccaagctgggctcgtggatgcgtgaacat
ggggtattaatcagcgctggcccaatcacccgaatgattactcacatcaatatcagccgt
acggatttggaaaaagtcgtcgcgctatggcgtgagtttttgagcgagcagcgatcatga

DBGET integrated database retrieval system