KEGG   Yersinia enterocolitica 2516-87: CH48_1048Help
Entry
CH48_1048         CDS       T03644                                 

Definition
(GenBank) sucrose-6-phosphate hydrolase family protein
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
yet  Yersinia enterocolitica 2516-87
Pathway
yet00052  Galactose metabolism
yet00500  Starch and sucrose metabolism
yet01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:yet00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    CH48_1048
   00500 Starch and sucrose metabolism
    CH48_1048
Enzymes [BR:yet01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     CH48_1048
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C Glyco_hydro_43
Motif
Other DBs
NCBI-ProteinID: AJJ27475
Position
1184051..1185460
Genome map
AA seq 469 aa AA seqDB search
MQEASLLKHLTLAVMRGQTRALQDPHRPGWHLAPCVGLLNDPNGFIYHAGYYHLFYQWNP
LDCRHGSKYWGHWRSTDLVHWEHQPVALVPSEAYESHGCYSGSAVIADDLITLIYTGNVK
YPDGSRTAFQCLAQENKRGEFDKLGPVLPLPAGYTGHVRDPKVWQHDGQWYMVLGAQDQQ
LQGKVLLLRSGDLREWHNLSEIAGSGLGGLGPFGYMWECPDLFTLADKDVLIFCPQGIPA
EAERYRNTFQAGYLLGKLDYANATFNHQAFHELDAGFEFYAPQTTLAADGRRLLFGWMGI
PDEDEFYQPTVEYGWIHTMTCPRELSLNGNKLIQQPARELAALRCEHTQWQGRAQEAPDL
AIGSAEMIIDVSAPFTLELGNTLLLEWDGACLILSRNNLRTGLREFRYWRGQLQQLQLLC
DRCSIEIFINQGQAVMTSSYFPPGAPQAIFAGSAELRVQHWLLSSPMLE
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaagccagtttgcttaaacatcttacgctggcagtgatgcgcggtcagacccgc
gcattacaagacccacaccggccgggctggcacttagcgccctgtgtcgggttgctgaat
gatcccaatgggtttatttatcatgctggctattatcatctgttttatcaatggaatccg
ctggattgccgccacggcagtaaatattggggccactggcgcagcactgacttagtgcat
tgggaacatcaaccagtggcattggtgccgagcgaagcctatgaaagtcatggttgttac
tccggttcggcggtgattgctgatgaccttatcaccttgatttacaccggaaatgtgaaa
taccccgatggctcccgtaccgcattccaatgtctggcacaggaaaataaacggggcgag
ttcgacaagttagggccagtgctcccattgcccgctggctataccggacatgtgcgtgac
ccgaaagtctggcagcacgacggccagtggtacatggtgttaggcgctcaggaccaacaa
ctacaaggcaaggtgctactgctgcgctctggtgatttacgcgaatggcataacctcagt
gagatagctggctctggtctgggggggcttgggccttttggctatatgtgggaatgcccc
gacctatttaccctggcagataaagacgttttgattttctgcccacagggtataccagca
gaagctgaacgctatcgtaatacctttcaggccggctatttactgggcaaattagattat
gccaacgccaccttcaatcatcaggcattccacgagttggacgctggctttgagttctat
gcgccgcaaaccacgctagccgcagatggtcgtcgcttattattcggctggatgggcatt
ccagatgaagatgaattttatcaaccaacagtggaatatggctggatccacaccatgact
tgcccacgcgagttgagtcttaatggcaacaaactgattcagcaaccggcccgcgagtta
gccgcgctgcggtgtgaacatacgcagtggcaaggccgtgcccaagaagcccctgatctt
gcgatcggtagcgccgaaatgataatcgacgtcagtgcgccttttaccctcgaattgggc
aatacactgctgttggaatgggatggtgcgtgcttgattttaagccgtaataatctacgc
accggattgcgggaattccgttactggcgcggtcaactgcaacaattacagttactttgt
gatcgttgcagcatagagatttttatcaatcagggacaagcggtgatgacgtcgagttac
ttcccaccaggagcgccacaagccatttttgcgggaagtgctgaactgcgagtgcaacac
tggctgttgtcttcgcccatgttagaatga

DBGET integrated database retrieval system