KEGG   Yersinia enterocolitica 2516-87: CH48_2517Help
Entry
CH48_2517         CDS       T03644                                 

Gene name
sorB
Definition
(GenBank) sorbose-specific phosphotransferase enzyme IIB component
  KO
K02813  PTS system, sorbose-specific IIB component [EC:2.7.1.206]
Organism
yet  Yersinia enterocolitica 2516-87
Pathway
yet00051  Fructose and mannose metabolism
yet01100  Metabolic pathways
yet02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:yet00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    CH48_2517 (sorB)
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    CH48_2517 (sorB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:yet02000]
    CH48_2517 (sorB)
Enzymes [BR:yet01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.206  protein-Npi-phosphohistidine---L-sorbose phosphotransferase
     CH48_2517 (sorB)
Transporters [BR:yet02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Sorbose-specific II component
    CH48_2517 (sorB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTSIIB_sorb
Motif
Other DBs
NCBI-ProteinID: AJJ25726
UniProt: A0A0E1NBE8
Position
complement(2808330..2808821)
Genome map
AA seq 163 aa AA seqDB search
MKINLARIDDRLIHGQVTTVWAKEAKAGRIIICSDDVYNDEIRKTLLKQAAPPGIKVNIV
NIEKAVAVYHNPNYINDTVFYLFTNPTDVLRLVDQGVKIDVINIGGMAFKHGKTQLTKAV
SVDQNDINAFYALAERGVHLDLRVVTSDPDVDVIKKLRELGSK
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcaatctggcaagaattgacgaccggctgattcatggtcaggtcaccacggtt
tgggccaaagaagctaaagctggacgtattattatttgtagtgacgacgtttataacgat
gaaattcggaaaacattattaaaacaggcagcaccgccgggaataaaagtgaatatcgtt
aatatagaaaaggcggtcgcggtttatcacaaccccaattatatcaatgacactgtgttt
tatttatttaccaatccaacagatgttttacgattggtagatcagggcgtgaaaattgat
gttattaatattggcggcatggcctttaaacatgggaaaacacaattaaccaaagcggta
tcagttgatcaaaatgacattaacgctttttatgcattagcagagcgcggtgttcattta
gatttacgggtagtcacttccgaccctgatgtggatgtgattaaaaagttacgcgagctg
gggtctaaataa

DBGET integrated database retrieval system