KEGG   Yersinia enterocolitica 2516-87: CH48_3052Help
Entry
CH48_3052         CDS       T03644                                 

Definition
(GenBank) S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase
  KO
K00121  S-(hydroxymethyl)glutathione dehydrogenase / alcohol dehydrogenase [EC:1.1.1.284 1.1.1.1]
Organism
yet  Yersinia enterocolitica 2516-87
Pathway
yet00010  Glycolysis / Gluconeogenesis
yet00071  Fatty acid degradation
yet00350  Tyrosine metabolism
yet00625  Chloroalkane and chloroalkene degradation
yet00626  Naphthalene degradation
yet00680  Methane metabolism
yet01100  Metabolic pathways
yet01110  Biosynthesis of secondary metabolites
yet01120  Microbial metabolism in diverse environments
yet01130  Biosynthesis of antibiotics
yet01200  Carbon metabolism
yet01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:yet00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CH48_3052
  09102 Energy metabolism
   00680 Methane metabolism
    CH48_3052
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CH48_3052
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    CH48_3052
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    CH48_3052
   00626 Naphthalene degradation
    CH48_3052
Enzymes [BR:yet01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     CH48_3052
    1.1.1.284  S-(hydroxymethyl)glutathione dehydrogenase
     CH48_3052
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 NADH_4Fe-4S
Motif
Other DBs
NCBI-ProteinID: AJJ29661
UniProt: A0A0E1NMI0
Position
complement(3396715..3397869)
Genome map
AA seq 384 aa AA seqDB search
MEMIKTRAAVAWGPNQPLSVEEVDLMPPQKGEVLVRIVASGVCHTDAYTLSGKDPEGVFP
AILGHEGGGIVEAIGEGVTSVAVGDHVIPLYTPECGECKFCRSGKTNLCQAIRSTQGKGL
MPDGTTRFSKNGQPIFHYMGTSTFSELTVVPEISLAKINKEAPLEEVCLLGCGVTTGMGA
VINTAKVKPGDTVAIFGLGGIGLSAVIGAQMAGASRIIGIDLNTSKFELARKLGATDLIN
PKDYDKPIQDVIVELTDGGVDFSFECIGNVNVMRSALECCHKGWGESVIIGVAGAGEEIS
TRPFQLVTGRVWRGSAFGGVKGRSELPGIVQQYLDGKFALNDFITHTMGLDQINEAFDLM
HEGKSIRTVIHFDQSSKKHTLQNK
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atggagatgattaaaacccgcgcagcagtcgcatgggggccaaaccagccattatccgtt
gaagaagttgatttgatgccaccacaaaaaggtgaagtactggtacggatcgtcgccagt
ggggtttgccacaccgacgcctacaccttatcgggcaaagatcctgaaggggtattcccg
gcaattctgggccatgaaggtggcgggattgttgaagcgattggcgaaggcgtgaccagt
gtcgcggtaggtgatcacgtgatcccactgtacacacctgaatgcggtgaatgtaaattc
tgtcgctccggcaaaactaacctgtgtcaggcaattcgcagcactcaaggtaaaggcttg
atgcccgatggcaccactcgcttctcgaagaatggccagcctattttccattatatgggc
acttcaactttttctgaattgaccgtcgtaccagaaatatcactggcaaaaatcaataaa
gaagcaccattagaagaagtttgtttgttaggttgtggtgtaaccactggtatgggggca
gttatcaatactgccaaagtgaaaccgggcgacacagtggctatcttcggcttgggtggt
attggcttgtctgcggttattggcgcacaaatggccggtgccagtcggattatcgggatc
gatctcaataccagcaaattcgagctggcccgcaaactgggtgctactgacctgattaac
ccgaaagattatgataaacccattcaggatgtgattgtcgagctgactgatggcggcgtc
gatttctcatttgaatgtattggtaacgtcaatgtcatgcgttcagctttagagtgctgc
cataaaggttggggcgaatcagttattattggtgtcgctggtgcaggtgaagaaatttca
acccgcccattccaactagtgacaggccgagtctggcgggggtctgcatttggtggcgta
aaaggccgctcagaattaccgggtattgtgcagcaatatctggatggaaaatttgcccta
aatgatttcatcactcataccatgggcttggatcaaatcaatgaagcctttgatttgatg
catgaaggcaaatctatccgtaccgtgattcattttgatcagtcatcaaaaaagcatact
ttacaaaataaatag

DBGET integrated database retrieval system