KEGG   Yersinia enterocolitica 2516-87: CH48_3094Help
Entry
CH48_3094         CDS       T03644                                 

Definition
(GenBank) mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase
  KO
K00971  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
yet  Yersinia enterocolitica 2516-87
Pathway
yet00051  Fructose and mannose metabolism
yet00520  Amino sugar and nucleotide sugar metabolism
yet01100  Metabolic pathways
yet01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:yet00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    CH48_3094
   00520 Amino sugar and nucleotide sugar metabolism
    CH48_3094
Enzymes [BR:yet01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     CH48_3094
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase MannoseP_isomer NTP_transf_3 Cupin_2 AraC_binding CENP-C_C
Motif
Other DBs
NCBI-ProteinID: AJJ29604
Position
3448171..3449586
Genome map
AA seq 471 aa AA seqDB search
MLLPVIMAGGTGSRLWPMSRELYPKQFLRLHGVNSMLQETVNRLEGISVREPVVICNEEH
RFLVAEQLRQINKLSHNIILEPVGRNTAPAIALAALNAVSQGDDPIMLVLAADHIINDCD
AFHQAVRDALPFAERGSLVTFGIVPTGPETGYGYIQRGEVTVNELSEAFKVKRFVEKPDT
ETAEQYISSDEYYWNSGMFMFRAKRYIQELEKFRPDILDACKAAMKDSDSDKDFITIDKD
KFSACPDESIDYAVMEQTSNAVVVPLDAGWSDVGSWSALWDVSSKDKSGNSVTGDTFLHD
TQNCYINTDEKLVAAVGVDNLVIVSTKDAVLVVDKSKVQDVKKIVEHLKQTKRSEYRRHR
EIYRPWGRCDIVVNEQRFNVNRITVKAGGAFSMQMHHHRAEHWIVLSGTAKVTIADKTFL
ITENQSTFIPIGSLHMLENPGQIPLELIEVQSGSYLGDDDIIRIKDHYGRC
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgttacttccggtgattatggctggtggaacaggcagtcgtctgtggccgatgtcaaga
gagctttatcccaaacagttcttacgattacatggggtaaattcgatgctgcaggagact
gtaaatcgtttagaaggaatttctgttagagaaccggttgtcatttgtaatgaagagcat
cgcttcttagtggccgaacagttgaggcaaataaataaattatcacacaatatcatatta
gagcctgtcggacgtaatactgctcctgctattgcgttagccgcactaaacgctgtctct
caaggcgacgatccaataatgttggtgttagcagccgatcatatcatcaatgactgtgat
gctttccaccaagcggtaagggatgcacttccgtttgctgaaagaggcagtctagtgacc
tttggtattgtgccaactggccctgaaactggttatggctatatacagcggggtgaagtg
acggttaatgagctttctgaagcattcaaggttaaacgttttgttgaaaaaccagataca
gagacggcagagcaatatatcagctcggatgagtactactggaatagcggtatgttcatg
tttcgcgctaaacgatatattcaagaattagagaagttcagacctgatattcttgatgcg
tgcaaagcggcgatgaaagattcggactcggacaaagattttatcactatcgataaagat
aaattcagcgcttgtccagatgagtcgatagactatgctgtgatggagcagaccagtaat
gccgttgttgttccgcttgatgcaggttggagcgacgttggctcttggtctgcattatgg
gatgtgagtagcaaagacaaatcaggtaattccgttaccggggacacattcctacatgat
acccaaaattgctacatcaatactgatgaaaaattagttgcggcggtaggagtagataac
ttagtcattgttagcactaaagatgcggttttggtggtagataaatcaaaagttcaagat
gttaaaaagattgtcgagcacctcaaacaaacaaaacgcagtgaatatcgccgccacaga
gaaatttatcgtccttggggacgttgtgatattgtggttaatgaacaacgttttaatgtt
aaccgcattacagttaaagctggtggtgcattctctatgcaaatgcatcatcaccgagca
gaacattggattgtgttatccggcactgcaaaagtgactatcgcggacaagacattttta
attactgaaaatcagtctacttttattcccattggttccctccatatgctagaaaatcca
ggtcaaattccactcgaactcatagaagttcaatcaggttcctacttaggtgatgatgat
attatcagaattaaagaccactatggccgttgctaa

DBGET integrated database retrieval system