KEGG   Yersinia enterocolitica 2516-87: CH48_4095Help
Entry
CH48_4095         CDS       T03644                                 

Definition
(GenBank) sucrose-6-phosphate hydrolase family protein
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
yet  Yersinia enterocolitica 2516-87
Pathway
yet00052  Galactose metabolism
yet00500  Starch and sucrose metabolism
yet01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:yet00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    CH48_4095
   00500 Starch and sucrose metabolism
    CH48_4095
Enzymes [BR:yet01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     CH48_4095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C DUF4975
Motif
Other DBs
NCBI-ProteinID: AJJ28804
Position
complement(4482196..4483665)
Genome map
AA seq 489 aa AA seqDB search
MNPLIERANDALQTLASQVGQNFYPHYHLAPLAGWMNDPNGLIFFNGQYHAFYQHHPYDE
NWGPMHWGHATSHDMLSWQHQCIALAPGDLWDKDGCFSGCAVDDNGVLSLIYTGHVWLKG
EGDDSAIREVQCLATSQDGIHFDKQGVVLNPPVGIMHFRDPKVWFEDDCWWMVVGARDER
DHGQVLLYRGNSLQQWQFMQVLACADDSMGYMWECPDFFPLGNERILMFSPQGLAAKGYL
NRNLFQSGVLRGKWQPGADFKPSQPFTELDLGHDFYAPQSLLTADGRRVIIGWMDMWQSP
MPTKADNWSGCLTLPRELSIDCDGNLLIKAVREVEALRQTGEFITSMTLAQEKQLLHENC
QSLELQLTWDTTASHAERYGVQLADAQGTGGKVSVYVDNQANRLVLDRYYPQYGLTGYRS
VALPEQGLLSLRIFIDGSSLEVFINDGQACMSSRIYPTEHERCLSLYAENGQAELLHGEY
WQLVAKSSR
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgaatccattaattgaacgggccaatgatgcactgcaaactttagcttctcaggttggc
caaaatttctatccacattatcatttggctccgctggcagggtggatgaatgaccccaac
gggttgatcttttttaacggacagtatcacgcgttttatcagcatcacccttatgatgaa
aattgggggccgatgcattggggccatgcgaccagccacgacatgttgagttggcaacat
caatgcattgccttagcaccgggtgatttatgggataaagacggctgtttttctggttgt
gcggtagacgataatggcgtgttaagcctgatttataccggacatgtttggcttaaaggt
gagggtgatgacagcgctattcgcgaggtgcagtgcctggcaaccagtcaggatggcata
cattttgacaaacaaggtgtggtactgaacccgcccgtgggaatcatgcatttccgcgat
ccgaaagtgtggtttgaagatgattgttggtggatggtggtcggtgctcgagatgagcga
gatcatgggcaagtcttactatatcgcggcaattcattgcagcaatggcaatttatgcaa
gttttagcgtgtgcagacgacagcatgggatatatgtgggaatgtccagatttcttccca
ttagggaatgaacgcattctgatgttttcaccgcaggggctggcagcaaaaggttacctc
aatcgcaatttgttccaaagtggtgtcttacgtggcaaatggcagccaggagccgatttt
aagccatcgcagccttttaccgaactggatctgggccatgatttctatgcgcctcaatcc
ctacttacggctgatgggcggcgagtcattattggttggatggatatgtggcaatcgcct
atgccgaccaaggccgataattggagtggctgcttaaccttgccacgagaattaagtatt
gattgtgatggtaatttattaataaaagcggtacgggaggttgaagcactaaggcaaacc
ggtgaattcatcacatcaatgacactggcccaagagaaacaacttttacatgaaaattgc
cagagtctggaactgcaattgacgtgggataccacagccagtcatgcagaaagatatggg
gtgcagttagctgatgcccaaggaactggtggtaaagtttcggtttatgtcgataatcag
gctaatcgactagttttggataggtattacccacaatatggactgacggggtatcgcagt
gtggcattaccagaacaggggttattatcattacgtatatttattgatggttcgtcgttg
gaggtatttatcaatgacgggcaagcttgtatgagcagtcgtatctacccaaccgagcat
gaacgctgtttatctctgtatgcggagaatggtcaggccgagctactacacggcgaatac
tggcagttagtagctaaatcatcacgttga

DBGET integrated database retrieval system