KEGG   Yersinia enterocolitica WA: CH47_1167Help
Entry
CH47_1167         CDS       T03643                                 

Gene name
rlmA
Definition
(GenBank) ribosomal RNA large subunit methyltransferase A
  KO
K00563  23S rRNA (guanine745-N1)-methyltransferase [EC:2.1.1.187]
Organism
yew  Yersinia enterocolitica WA
Brite
KEGG Orthology (KO) [BR:yew00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:yew03009]
    CH47_1167 (rlmA)
Enzymes [BR:yew01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.187  23S rRNA (guanine745-N1)-methyltransferase
     CH47_1167 (rlmA)
Ribosome biogenesis [BR:yew03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    CH47_1167 (rlmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_31 Methyltransf_25 Methyltransf_11 Methyltransf_23 Ubie_methyltran Methyltransf_32 Methyltransf_12 MTS PCMT RrnaAD Methyltransf_29
Motif
Other DBs
NCBI-ProteinID: AJI82897
UniProt: A0A0T9STM8
Position
1242151..1243011
Genome map
AA seq 286 aa AA seqDB search
MSYQCPLCHQALQQSPQQWRCSNNHQFDCAKEGYVNLMPVQHKGSKQPGDSPEMMQARRA
FLDAGYYQPLQQQVCDILDKALPQDAAMLLDIGCGEGYYTAAVADRLNRQRQMAIFGLDV
AKVAVRYGAKRYPQVSFCVASSHRLPFANHALDAVLRIYAPCKATELARTVKPGGIVVTV
APGPRHLYQLKALIYAQVQLHDDTPEHLDGFDLISSKNLAYELKLTGKQSFNLLQMTPFA
WRASIETGQELAARPSFVCETDFVIAVHRRREDLASTALSSDEKLI
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgtcttatcagtgccccctttgtcatcaggccttgcagcaaagcccgcaacagtggcgt
tgcagcaataatcaccagtttgattgcgccaaagagggttacgtcaatttaatgccggtg
cagcataaagggtcgaaacagccaggggatagcccagagatgatgcaggctcggcgggct
tttctggatgcgggttattatcaacccttgcaacagcaggtttgcgatattctggataag
gcgctgccacaggatgccgctatgttgttggatatcggttgtggcgaaggttattacacc
gccgcagtggcggatcgattaaatcggcaacgtcagatggctattttcgggttagatgtc
gctaaggttgccgtcagatacggcgcaaaacgctatcctcaagtgagtttttgtgtcgcg
tcgagccatcggttaccttttgctaatcatgctcttgatgcagtgttacgtatttatgcc
ccatgtaaggcaacggaattagctcgcactgtgaaaccaggtggcatcgttgttactgtt
gcgcctggcccgcgccatctctatcagttaaaagccctgatttatgctcaagtacaactt
cacgacgatacgccagagcatttggatgggtttgatctgattagcagtaaaaatttggcc
tacgaactgaagttaaccggtaaacaaagcttcaatttattgcagatgacgccttttgcc
tggcgcgcttccattgaaactggacaagaactcgctgcccggccgtcctttgtctgtgaa
accgattttgttatcgccgttcatcgccggagagaagatcttgcgagtacagcattaagc
agtgacgaaaagctaatataa

DBGET integrated database retrieval system