KEGG   Yersinia enterocolitica WA: CH47_1433Help
Entry
CH47_1433         CDS       T03643                                 

Definition
(GenBank) formate--tetrahydrofolate ligase family protein
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
yew  Yersinia enterocolitica WA
Pathway
yew00670  One carbon pool by folate
yew01100  Metabolic pathways
yew01120  Microbial metabolism in diverse environments
yew01200  Carbon metabolism
Module
yew_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:yew00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    CH47_1433
Enzymes [BR:yew01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     CH47_1433
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS
Motif
Other DBs
NCBI-ProteinID: AJI84722
UniProt: A0A0T9S5S1
Position
complement(1479764..1481521)
Genome map
AA seq 585 aa AA seqDB search
MTPTLSSSADVLPSLSNMSSETNLLPIQQIAPQLGLSADDLIPYGHHMAKVDISALRPSG
PQGKLILVSSITPTPLGEGKTVTTIGLSQGINRLGYRGVACIRQPSLGPVFGVKGGAAGG
GAAQVLPMEKLNLHLTGDIHAISAAHNLAAAALDARLYHEQRLGAVFSQQTGMPLLNIDA
QQILWPRVVDHNDRALRHIQVGVGGGTHGVERHDHVEITAASELMAILALSESLHDMRQR
IGRIILAHSTSGQAITADDLGVAGAMTALMKETIHPTLMQTSEQTPVLIHAGPFANIAHG
NSSVLADRLGLQLADYVVTEAGFGSDMGMEKFFNIKYRQSGIAPSCVVLVATLRSLKANS
GVFDIKPGQPLPAEILNTNIPLLSQGCANLKWHINNAKSYGLPVVVAVNCFPDDSPEELA
FLADYALSAGAIACDISEAFAKGGAGTTALAQRVIDACAHASPPVLAYPDNASLEQKIEI
LAQRYGAREVTFTPQARQQLDSITAAGFGHLPLCIAKTPLSISADASLKNVPHDFVLPVT
ACAVSAGAGFVRIYAGDIMTMPGLGTQPAYYHIDIDDEGCIRGLS
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atgacaccgacactgtcttcctctgccgatgtactcccttcgctatcaaatatgagttct
gaaacaaatttgcttcccattcagcaaattgcaccacaattaggcctgagcgcagatgat
ttaatcccctatgggcaccatatggcgaaagttgatatcagtgcattacggcccagtggc
ccacaaggcaaactgattctggtttccagcattactccgacgccgttgggagaaggtaaa
accgtcacgaccattggtttaagtcagggaatcaaccgcttaggctatcgtggggtagct
tgcatccgccaaccgagccttggcccagtctttggtgttaaagggggagccgcaggcggt
ggtgcagcacaagtgttacccatggagaaattgaacctgcatctgaccggtgatatccat
gctattagcgcggcacataatctggcagcggcggcgctggatgcacgtctgtatcatgaa
cagcgcttgggcgcggtttttagtcaacaaaccgggatgccactgcttaatattgatgct
caacagatcctatggccgcgagtggttgaccataatgatcgggcgctgcgccatattcag
gtcggtgtgggcggcggtactcacggtgttgagcggcacgaccatgtggaaattaccgcg
gcatcagaacttatggccattctggcgttgtcagaaagcttgcacgacatgcgccaacgc
attggccggataattttggcccacagcactagcggtcaagccattacggctgatgatttg
ggggtagcaggtgccatgacggcgctaatgaaagagaccatccacccgacactgatgcaa
accagtgaacagacgccggtgcttatccacgctgggccatttgccaacattgctcacggg
aattcttcagtgctggctgaccgtctgggattgcagttagcagactatgtggtaacggaa
gcgggcttcggttctgatatgggcatggagaagttctttaatatcaagtatcggcaatct
ggtattgcgccatcctgtgtggttctggtcgccacattacgtagcctgaaagccaatagt
ggtgtttttgatatcaaaccgggccaacctctgcctgctgaaattctcaatactaatatt
cctttattaagccaagggtgtgccaatctaaaatggcatattaataatgccaaaagctat
ggcttaccggtggtggtggccgtcaattgcttccctgacgacagcccggaagaactggcc
tttttagccgactatgcgctatcagctggcgcaattgcctgtgacatcagtgaggctttt
gcaaaaggtggcgcgggcaccaccgccttggctcagcgcgttatcgatgcttgcgctcat
gcatctccccctgtactggcgtaccctgacaatgcctcattggagcagaaaatagagatt
ttggcgcagcgctatggtgctcgtgaagtcactttcaccccacaagcgcgtcagcagctt
gactcaatcacggcggcaggttttggtcatttaccgctgtgtatcgccaaaacaccgttg
tccatcagcgcagatgccagcttgaagaatgttccacatgacttcgtgttgcctgtcaca
gcctgtgcggtgtcagccggtgccggatttgtgcgcatttatgctggggatattatgacc
atgccgggcctgggaacacagcctgcgtattatcatattgatatagatgacgaagggtgt
attcgcgggttaagctag

DBGET integrated database retrieval system